Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | bsrE-as-bsrE/- |
Location | 3086169..3086415 | Replicon | chromosome |
Accession | NZ_CP120613 | ||
Organism | Bacillus subtilis strain DSM 23521 |
Toxin (Protein)
Gene name | bsrE | Uniprot ID | - |
Locus tag | P5649_RS16590 | Protein ID | WP_109789044.1 |
Coordinates | 3086323..3086415 (-) | Length | 31 a.a. |
Antitoxin (RNA)
Gene name | as-bsrE | ||
Locus tag | - | ||
Coordinates | 3086169..3086342 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5649_RS16570 | 3082083..3082640 | + | 558 | WP_004399321.1 | SMI1/KNR4 family protein | - |
P5649_RS16575 | 3082742..3084544 | + | 1803 | WP_004399481.1 | LXG family T7SS effector ribonuclease toxin YobL | - |
P5649_RS16580 | 3084554..3085012 | + | 459 | WP_003231326.1 | type VII secretion system immunity protein YobK | - |
P5649_RS16585 | 3085212..3086054 | + | 843 | WP_003231327.1 | hypothetical protein | - |
- | 3086169..3086342 | + | 174 | - | - | Antitoxin |
P5649_RS16590 | 3086323..3086415 | - | 93 | WP_109789044.1 | type I toxin-antitoxin system toxin BsrE | Toxin |
P5649_RS16595 | 3086704..3087036 | + | 333 | WP_026009814.1 | hypothetical protein | - |
P5649_RS16600 | 3087269..3090874 | + | 3606 | WP_004399367.1 | P-loop NTPase fold protein | - |
P5649_RS16605 | 3090921..3091256 | - | 336 | WP_009967409.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3076752..3100430 | 23678 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 31 a.a. Molecular weight: 3358.16 Da Isoelectric Point: 4.1840
>T275268 WP_109789044.1 NZ_CP120613:c3086415-3086323 [Bacillus subtilis]
MSTFQALMLMLAIGSFIIALLTYIEKIDLP
MSTFQALMLMLAIGSFIIALLTYIEKIDLP
Download Length: 93 bp
Antitoxin
Download Length: 174 bp
>AT275268 NZ_CP120613:3086169-3086342 [Bacillus subtilis]
TTACAATACATTACAGTGCATTTCTTTAATGAGAAATGCATAAAATAAAAAAGACCGAGGTGCTACCAACACCCCGGCTC
TGTACAAAAAGTTGCCCATCAAAGGGCTTGCTCGATGTGGTTCTAGGTAGGCCTATCCCTTCAGGTTCTGAGGCTCAAGG
GAGGTCTATTTTTT
TTACAATACATTACAGTGCATTTCTTTAATGAGAAATGCATAAAATAAAAAAGACCGAGGTGCTACCAACACCCCGGCTC
TGTACAAAAAGTTGCCCATCAAAGGGCTTGCTCGATGTGGTTCTAGGTAGGCCTATCCCTTCAGGTTCTGAGGCTCAAGG
GAGGTCTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|