Detailed information of TA system TA275227

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 101546..101972
• Replicon: plasmid p582_124850
• Accession: NZ_CP120569
• Organism: Escherichia coli strain 582

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: P5711_RS24350
• Protein ID: WP_096937776.1
• Coordinates: 101546..101671 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	101748..101972 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
P5711_RS24315 (96719)	96719..97120	-	402	WP_001369361.1	conjugal transfer relaxosome DNA-bindin protein TraY	-
P5711_RS24320 (97213)	97213..97902	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
P5711_RS24325 (98089)	98089..98472	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
P5711_RS24330 (98793)	98793..99395	+	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
P5711_RS24335 (99692)	99692..100513	-	822	WP_001234487.1	DUF932 domain-containing protein	-
P5711_RS24340 (100624)	100624..100920	-	297	WP_001272245.1	hypothetical protein	-
P5711_RS24345 (100972)	100972..101245	+	274	Protein_105	hypothetical protein	-
P5711_RS24350 (101546)	101546..101671	-	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
P5711_RS24355 (101613)	101613..101762	-	150	Protein_107	plasmid maintenance protein Mok	-
- (101748)	101748..101972	-	225	NuclAT_0	-	Antitoxin
- (101748)	101748..101972	-	225	NuclAT_0	-	Antitoxin
- (101748)	101748..101972	-	225	NuclAT_0	-	Antitoxin
- (101748)	101748..101972	-	225	NuclAT_0	-	Antitoxin
P5711_RS24360 (101941)	101941..102703	-	763	Protein_108	plasmid SOS inhibition protein A	-
P5711_RS24365 (102700)	102700..103134	-	435	WP_000845962.1	conjugation system SOS inhibitor PsiB	-
P5711_RS24370 (103203)	103203..105167	-	1965	WP_277686175.1	ParB/RepB/Spo0J family partition protein	-
P5711_RS24375 (105226)	105226..105459	-	234	WP_000005985.1	DUF905 family protein	-
P5711_RS24380 (105517)	105517..106056	-	540	WP_001593051.1	single-stranded DNA-binding protein	-
P5711_RS24385 (106082)	106082..106288	-	207	WP_000547969.1	hypothetical protein	-
P5711_RS24390 (106358)	106358..106438	+	81	Protein_114	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	iroB / iroC / iroD / iroE / iroN / vat	1..124850	124850
	-	flank	IS/Tn	-	-	106609..107580	971

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T275227 WP_096937776.1 NZ_CP120569:c101671-101546 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT275227 NZ_CP120569:c101972-101748 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGATTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin