Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 63429..63683 | Replicon | plasmid p582_124850 |
| Accession | NZ_CP120569 | ||
| Organism | Escherichia coli strain 582 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | P5711_RS24125 | Protein ID | WP_001312851.1 |
| Coordinates | 63429..63578 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 63622..63683 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5711_RS24085 (58682) | 58682..59797 | + | 1116 | Protein_53 | IS91 family transposase | - |
| P5711_RS24090 (59978) | 59978..60322 | - | 345 | WP_001553768.1 | hypothetical protein | - |
| P5711_RS24095 (60414) | 60414..60554 | - | 141 | WP_161956652.1 | hypothetical protein | - |
| P5711_RS24100 (61257) | 61257..62114 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| P5711_RS24105 (62107) | 62107..62589 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| P5711_RS24110 (62582) | 62582..62629 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| P5711_RS24115 (62620) | 62620..62871 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| P5711_RS24120 (62888) | 62888..63145 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| P5711_RS24125 (63429) | 63429..63578 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (63622) | 63622..63683 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (63622) | 63622..63683 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (63622) | 63622..63683 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (63622) | 63622..63683 | + | 62 | NuclAT_1 | - | Antitoxin |
| P5711_RS24130 (63939) | 63939..64013 | - | 75 | Protein_62 | endonuclease | - |
| P5711_RS24135 (64259) | 64259..64471 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| P5711_RS24140 (64607) | 64607..65167 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| P5711_RS24145 (65270) | 65270..66130 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| P5711_RS24150 (66189) | 66189..66935 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | iroB / iroC / iroD / iroE / iroN / vat | 1..124850 | 124850 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T275222 WP_001312851.1 NZ_CP120569:c63578-63429 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT275222 NZ_CP120569:63622-63683 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
