Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3864734..3865428 | Replicon | chromosome |
Accession | NZ_CP120568 | ||
Organism | Escherichia coli strain 582 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | A0A3P5GWS5 |
Locus tag | P5711_RS19095 | Protein ID | WP_001263488.1 |
Coordinates | 3864734..3865132 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | P5711_RS19100 | Protein ID | WP_000554758.1 |
Coordinates | 3865135..3865428 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3860322) | 3860322..3860402 | - | 81 | NuclAT_13 | - | - |
- (3860322) | 3860322..3860402 | - | 81 | NuclAT_13 | - | - |
- (3860322) | 3860322..3860402 | - | 81 | NuclAT_13 | - | - |
- (3860322) | 3860322..3860402 | - | 81 | NuclAT_13 | - | - |
P5711_RS19070 (3860998) | 3860998..3861456 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
P5711_RS19075 (3861717) | 3861717..3863174 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
P5711_RS19080 (3863231) | 3863231..3863752 | - | 522 | Protein_3733 | peptide chain release factor H | - |
P5711_RS19085 (3863748) | 3863748..3863954 | - | 207 | Protein_3734 | RtcB family protein | - |
P5711_RS19090 (3864272) | 3864272..3864724 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
P5711_RS19095 (3864734) | 3864734..3865132 | - | 399 | WP_001263488.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
P5711_RS19100 (3865135) | 3865135..3865428 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
P5711_RS19105 (3865480) | 3865480..3866535 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
P5711_RS19110 (3866606) | 3866606..3867391 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
P5711_RS19115 (3867363) | 3867363..3869075 | + | 1713 | Protein_3740 | flagellar biosynthesis protein FlhA | - |
P5711_RS19120 (3869299) | 3869299..3869796 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15559.90 Da Isoelectric Point: 6.9798
>T275218 WP_001263488.1 NZ_CP120568:c3865132-3864734 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQEAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQEAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3P5GWS5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |