Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 4537336..4537748 | Replicon | chromosome |
Accession | NZ_CP120567 | ||
Organism | Escherichia coli strain A0 34/86 |
Toxin (Protein)
Gene name | symE | Uniprot ID | S1NWQ7 |
Locus tag | P5707_RS22035 | Protein ID | WP_000132614.1 |
Coordinates | 4537407..4537748 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 4537336..4537412 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5707_RS22025 (4534011) | 4534011..4535480 | + | 1470 | WP_001540814.1 | type I restriction-modification system subunit M | - |
P5707_RS22030 (4535480) | 4535480..4537186 | + | 1707 | WP_001100194.1 | restriction endonuclease subunit S | - |
- (4537336) | 4537336..4537412 | - | 77 | NuclAT_6 | - | Antitoxin |
- (4537336) | 4537336..4537412 | - | 77 | NuclAT_6 | - | Antitoxin |
- (4537336) | 4537336..4537412 | - | 77 | NuclAT_6 | - | Antitoxin |
- (4537336) | 4537336..4537412 | - | 77 | NuclAT_6 | - | Antitoxin |
- (4537336) | 4537336..4537412 | - | 77 | NuclAT_7 | - | Antitoxin |
- (4537336) | 4537336..4537412 | - | 77 | NuclAT_7 | - | Antitoxin |
- (4537336) | 4537336..4537412 | - | 77 | NuclAT_7 | - | Antitoxin |
- (4537336) | 4537336..4537412 | - | 77 | NuclAT_7 | - | Antitoxin |
P5707_RS22035 (4537407) | 4537407..4537748 | + | 342 | WP_000132614.1 | endoribonuclease SymE | Toxin |
P5707_RS22040 (4537795) | 4537795..4538958 | - | 1164 | WP_225377659.1 | DUF1524 domain-containing protein | - |
P5707_RS22045 (4539006) | 4539006..4539888 | - | 883 | Protein_4308 | DUF262 domain-containing protein | - |
P5707_RS22050 (4540294) | 4540294..4541214 | - | 921 | WP_000181195.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
P5707_RS22055 (4541399) | 4541399..4542679 | + | 1281 | WP_021520478.1 | DUF445 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | cheD | 4521206..4539951 | 18745 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12266.07 Da Isoelectric Point: 8.4982
>T275199 WP_000132614.1 NZ_CP120567:4537407-4537748 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT275199 NZ_CP120567:c4537412-4537336 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|