Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 4186450..4187144 | Replicon | chromosome |
| Accession | NZ_CP120567 | ||
| Organism | Escherichia coli strain A0 34/86 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1PJQ2 |
| Locus tag | P5707_RS20375 | Protein ID | WP_001263500.1 |
| Coordinates | 4186450..4186848 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | P5707_RS20380 | Protein ID | WP_000554758.1 |
| Coordinates | 4186851..4187144 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5707_RS20350 (4181815) | 4181815..4182273 | - | 459 | WP_001291991.1 | xanthine phosphoribosyltransferase | - |
| P5707_RS20355 (4182534) | 4182534..4183991 | + | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
| P5707_RS20360 (4184048) | 4184048..4184662 | - | 615 | WP_000602123.1 | peptide chain release factor H | - |
| P5707_RS20365 (4184659) | 4184659..4185798 | - | 1140 | WP_000521561.1 | RNA ligase RtcB family protein | - |
| P5707_RS20370 (4185988) | 4185988..4186440 | - | 453 | WP_001059897.1 | GNAT family N-acetyltransferase | - |
| P5707_RS20375 (4186450) | 4186450..4186848 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| P5707_RS20380 (4186851) | 4186851..4187144 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| P5707_RS20385 (4187196) | 4187196..4188251 | - | 1056 | WP_001226168.1 | DNA polymerase IV | - |
| P5707_RS20390 (4188322) | 4188322..4189107 | - | 786 | WP_000207578.1 | putative lateral flagellar export/assembly protein LafU | - |
| P5707_RS20395 (4189079) | 4189079..4190791 | + | 1713 | Protein_3988 | flagellar biosynthesis protein FlhA | - |
| P5707_RS20400 (4190870) | 4190870..4191115 | + | 246 | WP_133258463.1 | hypothetical protein | - |
| P5707_RS20405 (4191110) | 4191110..4191607 | - | 498 | WP_000006241.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T275197 WP_001263500.1 NZ_CP120567:c4186848-4186450 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|