Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3910960..3911639 | Replicon | chromosome |
Accession | NZ_CP120567 | ||
Organism | Escherichia coli strain A0 34/86 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V0VBP6 |
Locus tag | P5707_RS19050 | Protein ID | WP_000057524.1 |
Coordinates | 3911337..3911639 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | P5707_RS19045 | Protein ID | WP_000806442.1 |
Coordinates | 3910960..3911301 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5707_RS19035 (3907204) | 3907204..3908136 | - | 933 | WP_000883041.1 | glutaminase A | - |
P5707_RS19040 (3908398) | 3908398..3910902 | + | 2505 | WP_021513535.1 | copper-exporting P-type ATPase CopA | - |
P5707_RS19045 (3910960) | 3910960..3911301 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
P5707_RS19050 (3911337) | 3911337..3911639 | - | 303 | WP_000057524.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P5707_RS19055 (3911772) | 3911772..3912566 | + | 795 | WP_000365177.1 | TraB/GumN family protein | - |
P5707_RS19060 (3912770) | 3912770..3913249 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
P5707_RS19065 (3913273) | 3913273..3914073 | + | 801 | WP_000439798.1 | hypothetical protein | - |
P5707_RS19070 (3914070) | 3914070..3914573 | + | 504 | WP_000667000.1 | hypothetical protein | - |
P5707_RS19075 (3914611) | 3914611..3916263 | - | 1653 | WP_000771760.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11839.47 Da Isoelectric Point: 10.2237
>T275195 WP_000057524.1 NZ_CP120567:c3911639-3911337 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHWDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHWDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|