Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 865355..866154 | Replicon | chromosome |
Accession | NZ_CP120567 | ||
Organism | Escherichia coli strain A0 34/86 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | Q8FDB4 |
Locus tag | P5707_RS04170 | Protein ID | WP_000347252.1 |
Coordinates | 865355..865819 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | P5707_RS04175 | Protein ID | WP_001296435.1 |
Coordinates | 865819..866154 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5707_RS04140 (860356) | 860356..860790 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
P5707_RS04145 (860808) | 860808..861686 | - | 879 | WP_001298314.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
P5707_RS04150 (861676) | 861676..862455 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
P5707_RS04155 (862466) | 862466..862939 | - | 474 | WP_001298322.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
P5707_RS04160 (862962) | 862962..864242 | - | 1281 | WP_000681923.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
P5707_RS04165 (864491) | 864491..865300 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
P5707_RS04170 (865355) | 865355..865819 | - | 465 | WP_000347252.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
P5707_RS04175 (865819) | 865819..866154 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
P5707_RS04180 (866303) | 866303..867874 | - | 1572 | WP_001273939.1 | galactarate dehydratase | - |
P5707_RS04185 (868249) | 868249..869583 | + | 1335 | WP_000979025.1 | galactarate/glucarate/glycerate transporter GarP | - |
P5707_RS04190 (869599) | 869599..870369 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17750.11 Da Isoelectric Point: 9.4947
>T275182 WP_000347252.1 NZ_CP120567:c865819-865355 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEESH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEESH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|