Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 621211..621813 | Replicon | chromosome |
Accession | NZ_CP120567 | ||
Organism | Escherichia coli strain A0 34/86 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | P5707_RS03015 | Protein ID | WP_000897302.1 |
Coordinates | 621211..621522 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | P5707_RS03020 | Protein ID | WP_000356397.1 |
Coordinates | 621523..621813 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5707_RS02985 (616240) | 616240..617025 | + | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
P5707_RS02990 (617124) | 617124..617723 | + | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
P5707_RS02995 (617717) | 617717..618589 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
P5707_RS03000 (618586) | 618586..619023 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
P5707_RS03005 (619068) | 619068..620009 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
P5707_RS03010 (620073) | 620073..620981 | - | 909 | WP_001331553.1 | alpha/beta hydrolase | - |
P5707_RS03015 (621211) | 621211..621522 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
P5707_RS03020 (621523) | 621523..621813 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
P5707_RS03025 (622172) | 622172..622450 | + | 279 | WP_001296612.1 | hypothetical protein | - |
P5707_RS03030 (622846) | 622846..623064 | + | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
P5707_RS03035 (623288) | 623288..624217 | - | 930 | WP_001553788.1 | formate dehydrogenase accessory protein FdhE | - |
P5707_RS03040 (624214) | 624214..624849 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
P5707_RS03045 (624846) | 624846..625748 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T275181 WP_000897302.1 NZ_CP120567:621211-621522 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|