Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 185108..185330 | Replicon | chromosome |
Accession | NZ_CP120567 | ||
Organism | Escherichia coli strain A0 34/86 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | A0A829L523 |
Locus tag | P5707_RS00870 | Protein ID | WP_000170738.1 |
Coordinates | 185223..185330 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 185108..185174 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5707_RS00850 | 180549..181451 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
P5707_RS00855 | 181462..182445 | + | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
P5707_RS00860 | 182442..183446 | + | 1005 | WP_000103580.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
P5707_RS00865 | 183476..184747 | - | 1272 | WP_001298005.1 | aromatic amino acid transport family protein | - |
- | 185108..185174 | - | 67 | - | - | Antitoxin |
P5707_RS00870 | 185223..185330 | + | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
P5707_RS00875 | 185706..185813 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
P5707_RS00880 | 185899..187578 | - | 1680 | WP_000191567.1 | cellulose biosynthesis protein BcsG | - |
P5707_RS00885 | 187575..187766 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
P5707_RS00890 | 187763..189334 | - | 1572 | WP_001204945.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
P5707_RS00895 | 189607..189795 | + | 189 | WP_001063314.1 | cellulose biosynthesis protein BcsR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3864.67 Da Isoelectric Point: 9.0157
>T275180 WP_000170738.1 NZ_CP120567:185223-185330 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
Download Length: 108 bp
>T275180 NZ_CP120567:185223-185330 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT275180 NZ_CP120567:c185174-185108 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|