Detailed information of TA system TA275177

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 96045..96462
• Replicon: plasmid pH22_122286
• Accession: NZ_CP120564
• Organism: Escherichia coli strain H22

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: P5708_RS25090
• Protein ID: WP_096937776.1
• Coordinates: 96045..96170 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	96268..96462 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
P5708_RS25055 (91089)	91089..91448	-	360	WP_019842731.1	type IV conjugative transfer system pilin TraA	-
P5708_RS25060 (91482)	91482..91709	-	228	WP_019842732.1	conjugal transfer relaxosome protein TraY	-
P5708_RS25065 (91828)	91828..92475	-	648	WP_019842733.1	transcriptional regulator TraJ family protein	-
P5708_RS25070 (92670)	92670..93053	-	384	WP_019842734.1	conjugal transfer relaxosome DNA-binding protein TraM	-
P5708_RS25075 (93329)	93329..93976	+	648	WP_019842735.1	transglycosylase SLT domain-containing protein	-
P5708_RS25080 (94272)	94272..95092	-	821	Protein_105	DUF932 domain-containing protein	-
P5708_RS25085 (95211)	95211..95498	-	288	WP_001523521.1	hypothetical protein	-
P5708_RS25090 (96045)	96045..96170	-	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
P5708_RS25095 (96112)	96112..96261	-	150	Protein_108	DUF5431 family protein	-
- (96268)	96268..96462	-	195	NuclAT_0	-	Antitoxin
- (96268)	96268..96462	-	195	NuclAT_0	-	Antitoxin
- (96268)	96268..96462	-	195	NuclAT_0	-	Antitoxin
- (96268)	96268..96462	-	195	NuclAT_0	-	Antitoxin
P5708_RS25100 (96452)	96452..97235	-	784	Protein_109	plasmid SOS inhibition protein A	-
P5708_RS25105 (97232)	97232..97666	-	435	WP_001297861.1	conjugation system SOS inhibitor PsiB	-
P5708_RS25110 (97721)	97721..99685	-	1965	WP_277708175.1	ParB/RepB/Spo0J family partition protein	-
P5708_RS25115 (99751)	99751..99984	-	234	WP_000005990.1	DUF905 family protein	-
P5708_RS25120 (100047)	100047..100574	-	528	WP_019842803.1	single-stranded DNA-binding protein	-
P5708_RS25125 (100600)	100600..100806	-	207	WP_019842804.1	hypothetical protein	-
P5708_RS25130 (100876)	100876..101383	+	508	Protein_115	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	iroB / iroC / iroD / iroE / iroN / papD / papC	1..122286	122286

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T275177 WP_096937776.1 NZ_CP120564:c96170-96045 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 195 bp

>AT275177 NZ_CP120564:c96462-96268 [Escherichia coli]
TCACACGGATTACCCGTAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATGGGCT
ATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGACAAA
AGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC

Structures

Antitoxin