Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 59179..59433 | Replicon | plasmid pH22_122286 |
| Accession | NZ_CP120564 | ||
| Organism | Escherichia coli strain H22 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | P5708_RS24885 | Protein ID | WP_001312851.1 |
| Coordinates | 59179..59328 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 59372..59433 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5708_RS24845 (54280) | 54280..55302 | - | 1023 | WP_277705726.1 | IS21-like element IS100 family transposase | - |
| P5708_RS24850 (55535) | 55535..55810 | - | 276 | WP_000421257.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| P5708_RS24855 (55810) | 55810..56094 | - | 285 | WP_024186511.1 | ribbon-helix-helix domain-containing protein | - |
| P5708_RS24860 (57007) | 57007..57864 | - | 858 | WP_019842754.1 | incFII family plasmid replication initiator RepA | - |
| P5708_RS24865 (57857) | 57857..58339 | - | 483 | WP_019842753.1 | hypothetical protein | - |
| P5708_RS24870 (58332) | 58332..58379 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| P5708_RS24875 (58370) | 58370..58621 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| P5708_RS24880 (58638) | 58638..58895 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| P5708_RS24885 (59179) | 59179..59328 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (59372) | 59372..59433 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (59372) | 59372..59433 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (59372) | 59372..59433 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (59372) | 59372..59433 | + | 62 | NuclAT_1 | - | Antitoxin |
| P5708_RS24890 (59690) | 59690..59764 | - | 75 | Protein_67 | endonuclease | - |
| P5708_RS24895 (60010) | 60010..60222 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| P5708_RS24900 (60358) | 60358..60918 | - | 561 | WP_019842752.1 | fertility inhibition protein FinO | - |
| P5708_RS24905 (60973) | 60973..61719 | - | 747 | WP_019842751.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | iroB / iroC / iroD / iroE / iroN / papD / papC | 1..122286 | 122286 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T275175 WP_001312851.1 NZ_CP120564:c59328-59179 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT275175 NZ_CP120564:59372-59433 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|