Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4817895..4818497 | Replicon | chromosome |
Accession | NZ_CP120563 | ||
Organism | Escherichia coli strain H22 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | P5708_RS23545 | Protein ID | WP_000897302.1 |
Coordinates | 4818186..4818497 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | P5708_RS23540 | Protein ID | WP_000356397.1 |
Coordinates | 4817895..4818185 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5708_RS23515 (4813968) | 4813968..4814870 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
P5708_RS23520 (4814867) | 4814867..4815502 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
P5708_RS23525 (4815499) | 4815499..4816428 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
P5708_RS23530 (4816644) | 4816644..4816862 | - | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
P5708_RS23535 (4817258) | 4817258..4817536 | - | 279 | WP_277698160.1 | hypothetical protein | - |
P5708_RS23540 (4817895) | 4817895..4818185 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
P5708_RS23545 (4818186) | 4818186..4818497 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
P5708_RS23550 (4818726) | 4818726..4819634 | + | 909 | WP_001331553.1 | alpha/beta hydrolase | - |
P5708_RS23555 (4819698) | 4819698..4820639 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
P5708_RS23560 (4820684) | 4820684..4821121 | - | 438 | WP_000560978.1 | D-aminoacyl-tRNA deacylase | - |
P5708_RS23565 (4821118) | 4821118..4821990 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
P5708_RS23570 (4821984) | 4821984..4822583 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
P5708_RS23575 (4822682) | 4822682..4823467 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T275172 WP_000897302.1 NZ_CP120563:c4818497-4818186 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|