Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-rdlD/SymE(toxin) |
| Location | 4214873..4215285 | Replicon | chromosome |
| Accession | NZ_CP120563 | ||
| Organism | Escherichia coli strain H22 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | S1NWQ7 |
| Locus tag | P5708_RS20795 | Protein ID | WP_000132614.1 |
| Coordinates | 4214944..4215285 (+) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 4214873..4214949 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5708_RS20785 (4211485) | 4211485..4212954 | + | 1470 | WP_001387312.1 | type I restriction-modification system subunit M | - |
| P5708_RS20790 (4212954) | 4212954..4214723 | + | 1770 | WP_201478626.1 | restriction endonuclease subunit S | - |
| - (4214873) | 4214873..4214949 | - | 77 | NuclAT_13 | - | Antitoxin |
| - (4214873) | 4214873..4214949 | - | 77 | NuclAT_13 | - | Antitoxin |
| - (4214873) | 4214873..4214949 | - | 77 | NuclAT_13 | - | Antitoxin |
| - (4214873) | 4214873..4214949 | - | 77 | NuclAT_13 | - | Antitoxin |
| - (4214873) | 4214873..4214949 | - | 77 | NuclAT_14 | - | Antitoxin |
| - (4214873) | 4214873..4214949 | - | 77 | NuclAT_14 | - | Antitoxin |
| - (4214873) | 4214873..4214949 | - | 77 | NuclAT_14 | - | Antitoxin |
| - (4214873) | 4214873..4214949 | - | 77 | NuclAT_14 | - | Antitoxin |
| P5708_RS20795 (4214944) | 4214944..4215285 | + | 342 | WP_000132614.1 | endoribonuclease SymE | Toxin |
| P5708_RS20800 (4215332) | 4215332..4216495 | - | 1164 | WP_224153787.1 | DUF1524 domain-containing protein | - |
| P5708_RS20805 (4216549) | 4216549..4217425 | - | 877 | Protein_4075 | DUF262 domain-containing protein | - |
| P5708_RS20810 (4217831) | 4217831..4218751 | - | 921 | WP_001513532.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| P5708_RS20815 (4218936) | 4218936..4220216 | + | 1281 | WP_001338077.1 | DUF445 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | cheD | 4199261..4215285 | 16024 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12266.07 Da Isoelectric Point: 8.4982
>T275167 WP_000132614.1 NZ_CP120563:4214944-4215285 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT275167 NZ_CP120563:c4214949-4214873 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|