Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 605296..606095 | Replicon | chromosome |
Accession | NZ_CP120563 | ||
Organism | Escherichia coli strain H22 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | P5708_RS02970 | Protein ID | WP_000347251.1 |
Coordinates | 605296..605760 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | P5708_RS02975 | Protein ID | WP_001296435.1 |
Coordinates | 605760..606095 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5708_RS02940 (600297) | 600297..600731 | - | 435 | WP_000948837.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
P5708_RS02945 (600749) | 600749..601627 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
P5708_RS02950 (601617) | 601617..602396 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
P5708_RS02955 (602407) | 602407..602880 | - | 474 | WP_001298322.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
P5708_RS02960 (602903) | 602903..604183 | - | 1281 | WP_000681926.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
P5708_RS02965 (604432) | 604432..605241 | + | 810 | WP_089638240.1 | aga operon transcriptional regulator AgaR | - |
P5708_RS02970 (605296) | 605296..605760 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
P5708_RS02975 (605760) | 605760..606095 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
P5708_RS02980 (606244) | 606244..607815 | - | 1572 | WP_001273755.1 | galactarate dehydratase | - |
P5708_RS02985 (608190) | 608190..609524 | + | 1335 | WP_000979025.1 | galactarate/glucarate/glycerate transporter GarP | - |
P5708_RS02990 (609540) | 609540..610310 | + | 771 | WP_277699696.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T275154 WP_000347251.1 NZ_CP120563:c605760-605296 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PPV5 |