Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 63920..64184 Replicon plasmid pB771_95480
Accession NZ_CP120559
Organism Escherichia coli strain B771

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag P5709_RS26010 Protein ID WP_001331364.1
Coordinates 64032..64184 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 63920..63977 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5709_RS25995 (59159) 59159..61450 - 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -
P5709_RS26000 (61443) 61443..62513 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
P5709_RS26005 (62532) 62532..63740 - 1209 WP_000121274.1 IncI1-type conjugal transfer protein TrbA -
- (63920) 63920..63977 - 58 NuclAT_0 - Antitoxin
- (63920) 63920..63977 - 58 NuclAT_0 - Antitoxin
- (63920) 63920..63977 - 58 NuclAT_0 - Antitoxin
- (63920) 63920..63977 - 58 NuclAT_0 - Antitoxin
P5709_RS26010 (64032) 64032..64184 + 153 WP_001331364.1 Hok/Gef family protein Toxin
P5709_RS26015 (65008) 65008..65103 + 96 WP_000609148.1 DinQ-like type I toxin DqlB -
P5709_RS26020 (65168) 65168..65344 - 177 WP_001054904.1 hypothetical protein -
P5709_RS26025 (65736) 65736..65945 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
P5709_RS26030 (66017) 66017..66679 - 663 WP_000653334.1 plasmid IncI1-type surface exclusion protein ExcA -
P5709_RS26035 (66744) 66744..68906 - 2163 WP_000698351.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B - 1..95480 95480


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T275150 WP_001331364.1 NZ_CP120559:64032-64184 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT275150 NZ_CP120559:c63977-63920 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References