Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 63920..64184 | Replicon | plasmid pB771_95480 |
| Accession | NZ_CP120559 | ||
| Organism | Escherichia coli strain B771 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | P5709_RS26010 | Protein ID | WP_001331364.1 |
| Coordinates | 64032..64184 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 63920..63977 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5709_RS25995 (59159) | 59159..61450 | - | 2292 | WP_001289276.1 | F-type conjugative transfer protein TrbC | - |
| P5709_RS26000 (61443) | 61443..62513 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| P5709_RS26005 (62532) | 62532..63740 | - | 1209 | WP_000121274.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (63920) | 63920..63977 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (63920) | 63920..63977 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (63920) | 63920..63977 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (63920) | 63920..63977 | - | 58 | NuclAT_0 | - | Antitoxin |
| P5709_RS26010 (64032) | 64032..64184 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| P5709_RS26015 (65008) | 65008..65103 | + | 96 | WP_000609148.1 | DinQ-like type I toxin DqlB | - |
| P5709_RS26020 (65168) | 65168..65344 | - | 177 | WP_001054904.1 | hypothetical protein | - |
| P5709_RS26025 (65736) | 65736..65945 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| P5709_RS26030 (66017) | 66017..66679 | - | 663 | WP_000653334.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| P5709_RS26035 (66744) | 66744..68906 | - | 2163 | WP_000698351.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B | - | 1..95480 | 95480 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T275150 WP_001331364.1 NZ_CP120559:64032-64184 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT275150 NZ_CP120559:c63977-63920 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|