Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 102138..102555 | Replicon | plasmid pB771_128330 |
| Accession | NZ_CP120558 | ||
| Organism | Escherichia coli strain B771 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | P5709_RS25475 | Protein ID | WP_096937776.1 |
| Coordinates | 102138..102263 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 102361..102555 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5709_RS25440 (97391) | 97391..97792 | - | 402 | WP_001369361.1 | conjugal transfer relaxosome DNA-bindin protein TraY | - |
| P5709_RS25445 (97885) | 97885..98574 | - | 690 | WP_029400181.1 | conjugal transfer transcriptional regulator TraJ | - |
| P5709_RS25450 (98761) | 98761..99144 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| P5709_RS25455 (99465) | 99465..100067 | + | 603 | WP_000243709.1 | transglycosylase SLT domain-containing protein | - |
| P5709_RS25460 (100364) | 100364..101185 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| P5709_RS25465 (101304) | 101304..101591 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| P5709_RS25470 (101881) | 101881..102045 | - | 165 | WP_001716565.1 | hypothetical protein | - |
| P5709_RS25475 (102138) | 102138..102263 | - | 126 | WP_096937776.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| P5709_RS25480 (102205) | 102205..102354 | - | 150 | Protein_115 | DUF5431 family protein | - |
| - (102361) | 102361..102555 | - | 195 | NuclAT_0 | - | Antitoxin |
| - (102361) | 102361..102555 | - | 195 | NuclAT_0 | - | Antitoxin |
| - (102361) | 102361..102555 | - | 195 | NuclAT_0 | - | Antitoxin |
| - (102361) | 102361..102555 | - | 195 | NuclAT_0 | - | Antitoxin |
| P5709_RS25485 (102545) | 102545..103286 | - | 742 | Protein_116 | plasmid SOS inhibition protein A | - |
| P5709_RS25490 (103283) | 103283..103717 | - | 435 | WP_029400524.1 | conjugation system SOS inhibitor PsiB | - |
| P5709_RS25495 (103772) | 103772..105736 | - | 1965 | WP_001587501.1 | ParB/RepB/Spo0J family partition protein | - |
| P5709_RS25500 (105802) | 105802..106035 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
| P5709_RS25505 (106093) | 106093..106620 | - | 528 | WP_000290825.1 | single-stranded DNA-binding protein | - |
| P5709_RS25510 (106646) | 106646..106852 | - | 207 | WP_029400906.1 | hypothetical protein | - |
| P5709_RS25515 (106922) | 106922..107429 | + | 508 | Protein_122 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | papD / papC / papH | 1..128330 | 128330 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4806.72 Da Isoelectric Point: 8.4890
>T275146 WP_096937776.1 NZ_CP120558:c102263-102138 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 195 bp
>AT275146 NZ_CP120558:c102555-102361 [Escherichia coli]
TCACACGGATTACCCGTAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATGGGCT
ATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGACAAA
AGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
TCACACGGATTACCCGTAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATGGGCT
ATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGACAAA
AGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|