Detailed information of TA system TA275146

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 102138..102555
• Replicon: plasmid pB771_128330
• Accession: NZ_CP120558
• Organism: Escherichia coli strain B771

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: P5709_RS25475
• Protein ID: WP_096937776.1
• Coordinates: 102138..102263 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	102361..102555 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
P5709_RS25440 (97391)	97391..97792	-	402	WP_001369361.1	conjugal transfer relaxosome DNA-bindin protein TraY	-
P5709_RS25445 (97885)	97885..98574	-	690	WP_029400181.1	conjugal transfer transcriptional regulator TraJ	-
P5709_RS25450 (98761)	98761..99144	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
P5709_RS25455 (99465)	99465..100067	+	603	WP_000243709.1	transglycosylase SLT domain-containing protein	-
P5709_RS25460 (100364)	100364..101185	-	822	WP_001234469.1	DUF932 domain-containing protein	-
P5709_RS25465 (101304)	101304..101591	-	288	WP_000107535.1	hypothetical protein	-
P5709_RS25470 (101881)	101881..102045	-	165	WP_001716565.1	hypothetical protein	-
P5709_RS25475 (102138)	102138..102263	-	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
P5709_RS25480 (102205)	102205..102354	-	150	Protein_115	DUF5431 family protein	-
- (102361)	102361..102555	-	195	NuclAT_0	-	Antitoxin
- (102361)	102361..102555	-	195	NuclAT_0	-	Antitoxin
- (102361)	102361..102555	-	195	NuclAT_0	-	Antitoxin
- (102361)	102361..102555	-	195	NuclAT_0	-	Antitoxin
P5709_RS25485 (102545)	102545..103286	-	742	Protein_116	plasmid SOS inhibition protein A	-
P5709_RS25490 (103283)	103283..103717	-	435	WP_029400524.1	conjugation system SOS inhibitor PsiB	-
P5709_RS25495 (103772)	103772..105736	-	1965	WP_001587501.1	ParB/RepB/Spo0J family partition protein	-
P5709_RS25500 (105802)	105802..106035	-	234	WP_000005990.1	DUF905 family protein	-
P5709_RS25505 (106093)	106093..106620	-	528	WP_000290825.1	single-stranded DNA-binding protein	-
P5709_RS25510 (106646)	106646..106852	-	207	WP_029400906.1	hypothetical protein	-
P5709_RS25515 (106922)	106922..107429	+	508	Protein_122	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	papD / papC / papH	1..128330	128330

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T275146 WP_096937776.1 NZ_CP120558:c102263-102138 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 195 bp

>AT275146 NZ_CP120558:c102555-102361 [Escherichia coli]
TCACACGGATTACCCGTAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATGGGCT
ATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGACAAA
AGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC

Structures

Antitoxin