Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 64305..64559 | Replicon | plasmid pB771_128330 |
| Accession | NZ_CP120558 | ||
| Organism | Escherichia coli strain B771 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | P5709_RS25255 | Protein ID | WP_001312851.1 |
| Coordinates | 64305..64454 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 64498..64559 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5709_RS25220 (60317) | 60317..60664 | + | 348 | Protein_63 | IS1-like element IS1A family transposase | - |
| P5709_RS25225 (60680) | 60680..61000 | - | 321 | Protein_64 | serine acetyltransferase | - |
| P5709_RS25230 (61104) | 61104..61391 | - | 288 | WP_000222760.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| P5709_RS25235 (61388) | 61388..61639 | - | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| P5709_RS25240 (62603) | 62603..63460 | - | 858 | WP_029400224.1 | incFII family plasmid replication initiator RepA | - |
| P5709_RS25245 (63453) | 63453..63527 | - | 75 | WP_032144212.1 | RepA leader peptide Tap | - |
| P5709_RS25250 (63773) | 63773..64021 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| P5709_RS25255 (64305) | 64305..64454 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (64498) | 64498..64559 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (64498) | 64498..64559 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (64498) | 64498..64559 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (64498) | 64498..64559 | + | 62 | NuclAT_1 | - | Antitoxin |
| P5709_RS25260 (64735) | 64735..65237 | - | 503 | Protein_71 | DUF2726 domain-containing protein | - |
| P5709_RS25265 (65276) | 65276..65485 | - | 210 | WP_001299729.1 | hemolysin expression modulator Hha | - |
| P5709_RS25270 (65531) | 65531..65992 | - | 462 | WP_000978818.1 | thermonuclease family protein | - |
| P5709_RS25275 (66238) | 66238..66450 | - | 213 | WP_032303448.1 | hypothetical protein | - |
| P5709_RS25280 (66586) | 66586..67146 | - | 561 | WP_001567328.1 | fertility inhibition protein FinO | - |
| P5709_RS25285 (67200) | 67200..67946 | - | 747 | WP_000205764.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | papD / papC / papH | 1..128330 | 128330 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T275145 WP_001312851.1 NZ_CP120558:c64454-64305 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT275145 NZ_CP120558:64498-64559 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|