Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4416984..4417678 Replicon chromosome
Accession NZ_CP120557
Organism Escherichia coli strain B771

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag P5709_RS21475 Protein ID WP_001263493.1
Coordinates 4417280..4417678 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag P5709_RS21470 Protein ID WP_000554757.1
Coordinates 4416984..4417277 (+) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5709_RS21450 (4412624) 4412624..4413121 + 498 WP_000006260.1 REP-associated tyrosine transposase RayT -
P5709_RS21455 (4413337) 4413337..4415049 - 1713 Protein_4193 flagellar biosynthesis protein FlhA -
P5709_RS21460 (4415021) 4415021..4415806 + 786 WP_000207564.1 putative lateral flagellar export/assembly protein LafU -
P5709_RS21465 (4415877) 4415877..4416932 + 1056 WP_001226164.1 DNA polymerase IV -
P5709_RS21470 (4416984) 4416984..4417277 + 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
P5709_RS21475 (4417280) 4417280..4417678 + 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
P5709_RS21480 (4417688) 4417688..4418140 + 453 WP_001059847.1 GNAT family N-acetyltransferase -
P5709_RS21485 (4418386) 4418386..4418589 + 204 Protein_4199 RtcB family protein -
P5709_RS21490 (4418588) 4418588..4419109 + 522 Protein_4200 peptide chain release factor H -
P5709_RS21495 (4419166) 4419166..4420623 - 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
P5709_RS21500 (4420884) 4420884..4421342 + 459 WP_001291990.1 xanthine phosphoribosyltransferase -
- (4421938) 4421938..4422018 + 81 NuclAT_13 - -
- (4421938) 4421938..4422018 + 81 NuclAT_13 - -
- (4421938) 4421938..4422018 + 81 NuclAT_13 - -
- (4421938) 4421938..4422018 + 81 NuclAT_13 - -
P5709_RS21505 (4421434) 4421434..4422678 + 1245 WP_000189541.1 esterase FrsA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - gmhA/lpcA 4400642..4436752 36110


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T275140 WP_001263493.1 NZ_CP120557:4417280-4417678 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT275140 WP_000554757.1 NZ_CP120557:4416984-4417277 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References