Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2642547..2643274 | Replicon | chromosome |
Accession | NZ_CP120557 | ||
Organism | Escherichia coli strain B771 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | P5709_RS13065 | Protein ID | WP_000550189.1 |
Coordinates | 2642960..2643274 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | P5709_RS13060 | Protein ID | WP_000560255.1 |
Coordinates | 2642547..2642963 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5709_RS13050 (2637707) | 2637707..2640058 | + | 2352 | WP_000695486.1 | alpha-glucosidase | - |
P5709_RS13055 (2640484) | 2640484..2642502 | + | 2019 | WP_000121433.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
P5709_RS13060 (2642547) | 2642547..2642963 | - | 417 | WP_000560255.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
P5709_RS13065 (2642960) | 2642960..2643274 | - | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
P5709_RS13070 (2643558) | 2643558..2644694 | - | 1137 | WP_000018695.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
P5709_RS13075 (2644779) | 2644779..2645282 | + | 504 | WP_001300832.1 | M48 family metallopeptidase | - |
P5709_RS13080 (2645359) | 2645359..2646051 | + | 693 | WP_000942548.1 | vancomycin high temperature exclusion protein | - |
P5709_RS13085 (2646130) | 2646130..2647116 | + | 987 | WP_000617698.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T275136 WP_000550189.1 NZ_CP120557:c2643274-2642960 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14951.41 Da Isoelectric Point: 4.5577
>AT275136 WP_000560255.1 NZ_CP120557:c2642963-2642547 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNAPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNAPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|