Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 2576838..2577531 | Replicon | chromosome |
| Accession | NZ_CP120557 | ||
| Organism | Escherichia coli strain B771 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | P5709_RS12750 | Protein ID | WP_000415584.1 |
| Coordinates | 2577235..2577531 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | P5709_RS12745 | Protein ID | WP_000650107.1 |
| Coordinates | 2576838..2577233 (-) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5709_RS12735 (2572702) | 2572702..2574960 | - | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
| P5709_RS12740 (2575098) | 2575098..2576705 | - | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
| P5709_RS12745 (2576838) | 2576838..2577233 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| P5709_RS12750 (2577235) | 2577235..2577531 | - | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| P5709_RS12755 (2577736) | 2577736..2578218 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| P5709_RS12760 (2578271) | 2578271..2578663 | - | 393 | WP_001401138.1 | OB fold stress tolerance protein YgiW | - |
| P5709_RS12765 (2578815) | 2578815..2579474 | + | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
| P5709_RS12770 (2579471) | 2579471..2580820 | + | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
| P5709_RS12775 (2580866) | 2580866..2581198 | - | 333 | WP_000917684.1 | DUF2645 family protein | - |
| P5709_RS12780 (2581517) | 2581517..2582098 | + | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| P5709_RS12785 (2582129) | 2582129..2582443 | + | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T275135 WP_000415584.1 NZ_CP120557:c2577531-2577235 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT275135 WP_000650107.1 NZ_CP120557:c2577233-2576838 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|