Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 664874..665245 | Replicon | chromosome |
| Accession | NZ_CP120557 | ||
| Organism | Escherichia coli strain B771 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | F4VC37 |
| Locus tag | P5709_RS03500 | Protein ID | WP_001317028.1 |
| Coordinates | 665051..665245 (-) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 664874..665052 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5709_RS03470 (660626) | 660626..660799 | + | 174 | WP_001296046.1 | protein YnaL | - |
| P5709_RS03475 (660829) | 660829..662202 | + | 1374 | WP_000123737.1 | ATP-dependent RNA helicase DbpA | - |
| P5709_RS03480 (662331) | 662331..663266 | - | 936 | WP_001157407.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| P5709_RS03485 (663318) | 663318..664553 | - | 1236 | WP_000040858.1 | site-specific integrase | - |
| P5709_RS03490 (664555) | 664555..664770 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| - (664874) | 664874..665052 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (664874) | 664874..665052 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (664874) | 664874..665052 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (664874) | 664874..665052 | + | 179 | NuclAT_0 | - | Antitoxin |
| P5709_RS03495 (664849) | 664849..665058 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
| P5709_RS03500 (665051) | 665051..665245 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| P5709_RS03505 (665302) | 665302..666111 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
| P5709_RS03510 (666104) | 666104..668704 | - | 2601 | WP_000105139.1 | exodeoxyribonuclease VIII | - |
| P5709_RS03515 (668806) | 668806..669081 | - | 276 | WP_000632297.1 | protein RacC | - |
| P5709_RS03520 (669156) | 669156..669326 | - | 171 | WP_001352098.1 | YdaE family protein | - |
| P5709_RS03525 (669326) | 669326..669547 | - | 222 | WP_000560223.1 | killing protein KilR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 656059..679428 | 23369 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T275121 WP_001317028.1 NZ_CP120557:c665245-665051 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT275121 NZ_CP120557:664874-665052 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
