Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4897854..4898456 | Replicon | chromosome |
Accession | NZ_CP120549 | ||
Organism | Escherichia coli strain B1172 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A366YL64 |
Locus tag | P5710_RS23660 | Protein ID | WP_001519058.1 |
Coordinates | 4898145..4898456 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | P5710_RS23655 | Protein ID | WP_000356397.1 |
Coordinates | 4897854..4898144 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5710_RS23630 (4893927) | 4893927..4894829 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
P5710_RS23635 (4894826) | 4894826..4895461 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
P5710_RS23640 (4895458) | 4895458..4896387 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
P5710_RS23645 (4896603) | 4896603..4896821 | - | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
P5710_RS23650 (4897217) | 4897217..4897495 | - | 279 | WP_001296612.1 | hypothetical protein | - |
P5710_RS23655 (4897854) | 4897854..4898144 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
P5710_RS23660 (4898145) | 4898145..4898456 | - | 312 | WP_001519058.1 | hypothetical protein | Toxin |
P5710_RS23665 (4898685) | 4898685..4899593 | + | 909 | WP_001331553.1 | alpha/beta hydrolase | - |
P5710_RS23670 (4899657) | 4899657..4900598 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
P5710_RS23675 (4900643) | 4900643..4901080 | - | 438 | WP_000560990.1 | D-aminoacyl-tRNA deacylase | - |
P5710_RS23680 (4901077) | 4901077..4901949 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
P5710_RS23685 (4901943) | 4901943..4902542 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12202.25 Da Isoelectric Point: 10.1861
>T275115 WP_001519058.1 NZ_CP120549:c4898456-4898145 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYKIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYKIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|