Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4177922..4178180 | Replicon | chromosome |
Accession | NZ_CP120549 | ||
Organism | Escherichia coli strain B1172 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | - |
Locus tag | P5710_RS20265 | Protein ID | WP_001519334.1 |
Coordinates | 4178028..4178180 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 4177922..4177979 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5710_RS20250 | 4173751..4175010 | - | 1260 | WP_000494929.1 | hypothetical protein | - |
P5710_RS20255 | 4175139..4176632 | - | 1494 | WP_001350365.1 | sulfatase-like hydrolase/transferase | - |
P5710_RS20260 | 4176652..4177413 | - | 762 | WP_001274832.1 | outer membrane protein OmpK | - |
- | 4177922..4177979 | - | 58 | - | - | Antitoxin |
P5710_RS20265 | 4178028..4178180 | + | 153 | WP_001519334.1 | type I toxin-antitoxin system toxin MokC | Toxin |
P5710_RS20270 | 4178285..4179415 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
P5710_RS20275 | 4179504..4181420 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
P5710_RS20280 | 4181792..4182196 | + | 405 | WP_000843692.1 | DUF2541 family protein | - |
P5710_RS20285 | 4182222..4182935 | + | 714 | WP_001102393.1 | acidic protein MsyB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5515.59 Da Isoelectric Point: 7.1312
>T275111 WP_001519334.1 NZ_CP120549:4178028-4178180 [Escherichia coli]
MKQHKAMIIALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIIALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT275111 NZ_CP120549:c4177979-4177922 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|