Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3891412..3892106 | Replicon | chromosome |
| Accession | NZ_CP120549 | ||
| Organism | Escherichia coli strain B1172 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | A0A366YGZ3 |
| Locus tag | P5710_RS18905 | Protein ID | WP_001518358.1 |
| Coordinates | 3891412..3891810 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | L4JHF0 |
| Locus tag | P5710_RS18910 | Protein ID | WP_000554755.1 |
| Coordinates | 3891813..3892106 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5710_RS18880 (3886777) | 3886777..3887235 | - | 459 | WP_001291991.1 | xanthine phosphoribosyltransferase | - |
| P5710_RS18885 (3887496) | 3887496..3888953 | + | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
| P5710_RS18890 (3889010) | 3889010..3889624 | - | 615 | WP_000602123.1 | peptide chain release factor H | - |
| P5710_RS18895 (3889621) | 3889621..3890760 | - | 1140 | WP_000521578.1 | RNA ligase RtcB family protein | - |
| P5710_RS18900 (3890950) | 3890950..3891402 | - | 453 | WP_001059897.1 | GNAT family N-acetyltransferase | - |
| P5710_RS18905 (3891412) | 3891412..3891810 | - | 399 | WP_001518358.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| P5710_RS18910 (3891813) | 3891813..3892106 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| P5710_RS18915 (3892158) | 3892158..3893213 | - | 1056 | WP_001226170.1 | DNA polymerase IV | - |
| P5710_RS18920 (3893284) | 3893284..3894069 | - | 786 | WP_000207543.1 | putative lateral flagellar export/assembly protein LafU | - |
| P5710_RS18925 (3894041) | 3894041..3895753 | + | 1713 | Protein_3710 | flagellar biosynthesis protein FlhA | - |
| P5710_RS18930 (3895781) | 3895781..3896275 | + | 495 | WP_139174989.1 | hypothetical protein | - |
| P5710_RS18935 (3896270) | 3896270..3896767 | - | 498 | WP_000006241.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3841270..3897701 | 56431 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15448.85 Da Isoelectric Point: 8.0738
>T275109 WP_001518358.1 NZ_CP120549:c3891810-3891412 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMNKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMNKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366YGZ3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G9H5 |