Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4598385..4599139 | Replicon | chromosome |
| Accession | NZ_CP120397 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain 1521-2017_CI | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q8Z2U0 |
| Locus tag | PVA76_RS22660 | Protein ID | WP_000558160.1 |
| Coordinates | 4598385..4598696 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PVA76_RS22665 | Protein ID | WP_001259009.1 |
| Coordinates | 4598693..4599139 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVA76_RS22630 (PVA76_22625) | 4594051..4594953 | + | 903 | WP_000331359.1 | formate dehydrogenase subunit beta | - |
| PVA76_RS22635 (PVA76_22630) | 4594950..4595585 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PVA76_RS22640 (PVA76_22635) | 4595582..4596511 | + | 930 | WP_057492927.1 | formate dehydrogenase accessory protein FdhE | - |
| PVA76_RS22645 (PVA76_22640) | 4596549..4596923 | - | 375 | WP_000238494.1 | type II toxin-antitoxin system VapC family toxin | - |
| PVA76_RS22650 (PVA76_22645) | 4596923..4597165 | - | 243 | WP_001523745.1 | CopG family transcriptional regulator | - |
| PVA76_RS22655 (PVA76_22650) | 4597370..4598299 | + | 930 | WP_001162859.1 | alpha/beta hydrolase | - |
| PVA76_RS22660 (PVA76_22655) | 4598385..4598696 | + | 312 | WP_000558160.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PVA76_RS22665 (PVA76_22660) | 4598693..4599139 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PVA76_RS22670 (PVA76_22665) | 4599154..4600095 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PVA76_RS22675 (PVA76_22670) | 4600140..4600577 | - | 438 | WP_000560975.1 | D-aminoacyl-tRNA deacylase | - |
| PVA76_RS22680 (PVA76_22675) | 4600574..4601446 | - | 873 | WP_285238944.1 | virulence factor BrkB family protein | - |
| PVA76_RS22685 (PVA76_22680) | 4601440..4602039 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PVA76_RS22690 (PVA76_22685) | 4602230..4603033 | - | 804 | WP_000059689.1 | DeoR family transcriptional regulator | - |
| PVA76_RS22695 (PVA76_22690) | 4603067..4603963 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12449.38 Da Isoelectric Point: 8.4020
>T275034 WP_000558160.1 NZ_CP120397:4598385-4598696 [Salmonella enterica subsp. enterica serovar Typhi]
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT275034 WP_001259009.1 NZ_CP120397:4598693-4599139 [Salmonella enterica subsp. enterica serovar Typhi]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|