Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4598883..4599637 | Replicon | chromosome |
| Accession | NZ_CP120396 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain 1521-2017_CO_04 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q8Z2U0 |
| Locus tag | PVA80_RS22550 | Protein ID | WP_000558160.1 |
| Coordinates | 4598883..4599194 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PVA80_RS22555 | Protein ID | WP_001259009.1 |
| Coordinates | 4599191..4599637 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVA80_RS22520 (PVA80_22515) | 4594549..4595451 | + | 903 | WP_000331359.1 | formate dehydrogenase subunit beta | - |
| PVA80_RS22525 (PVA80_22520) | 4595448..4596083 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PVA80_RS22530 (PVA80_22525) | 4596080..4597009 | + | 930 | WP_057492927.1 | formate dehydrogenase accessory protein FdhE | - |
| PVA80_RS22535 (PVA80_22530) | 4597047..4597421 | - | 375 | WP_000238494.1 | type II toxin-antitoxin system VapC family toxin | - |
| PVA80_RS22540 (PVA80_22535) | 4597421..4597663 | - | 243 | WP_001523745.1 | CopG family transcriptional regulator | - |
| PVA80_RS22545 (PVA80_22540) | 4597868..4598797 | + | 930 | WP_001162859.1 | alpha/beta hydrolase | - |
| PVA80_RS22550 (PVA80_22545) | 4598883..4599194 | + | 312 | WP_000558160.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PVA80_RS22555 (PVA80_22550) | 4599191..4599637 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PVA80_RS22560 (PVA80_22555) | 4599652..4600593 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PVA80_RS22565 (PVA80_22560) | 4600638..4601075 | - | 438 | WP_000560975.1 | D-aminoacyl-tRNA deacylase | - |
| PVA80_RS22570 (PVA80_22565) | 4601072..4601944 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PVA80_RS22575 (PVA80_22570) | 4601938..4602537 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PVA80_RS22580 (PVA80_22575) | 4602728..4603531 | - | 804 | WP_000059689.1 | DeoR family transcriptional regulator | - |
| PVA80_RS22585 (PVA80_22580) | 4603565..4604461 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12449.38 Da Isoelectric Point: 8.4020
>T275018 WP_000558160.1 NZ_CP120396:4598883-4599194 [Salmonella enterica subsp. enterica serovar Typhi]
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT275018 WP_001259009.1 NZ_CP120396:4599191-4599637 [Salmonella enterica subsp. enterica serovar Typhi]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|