Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4680082..4680836 | Replicon | chromosome |
| Accession | NZ_CP120392 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain 2027-2019_CO_04_Copr1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q8Z2U0 |
| Locus tag | PVA84_RS23145 | Protein ID | WP_000558160.1 |
| Coordinates | 4680082..4680393 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PVA84_RS23150 | Protein ID | WP_001259009.1 |
| Coordinates | 4680390..4680836 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVA84_RS23115 (PVA84_23110) | 4675748..4676650 | + | 903 | WP_000331359.1 | formate dehydrogenase subunit beta | - |
| PVA84_RS23120 (PVA84_23115) | 4676647..4677282 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PVA84_RS23125 (PVA84_23120) | 4677279..4678208 | + | 930 | WP_000027727.1 | formate dehydrogenase accessory protein FdhE | - |
| PVA84_RS23130 (PVA84_23125) | 4678246..4678620 | - | 375 | WP_000238494.1 | type II toxin-antitoxin system VapC family toxin | - |
| PVA84_RS23135 (PVA84_23130) | 4678620..4678862 | - | 243 | WP_001523745.1 | CopG family transcriptional regulator | - |
| PVA84_RS23140 (PVA84_23135) | 4679067..4679996 | + | 930 | WP_001162859.1 | alpha/beta hydrolase | - |
| PVA84_RS23145 (PVA84_23140) | 4680082..4680393 | + | 312 | WP_000558160.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PVA84_RS23150 (PVA84_23145) | 4680390..4680836 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PVA84_RS23155 (PVA84_23150) | 4680851..4681792 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PVA84_RS23160 (PVA84_23155) | 4681837..4682274 | - | 438 | WP_000560975.1 | D-aminoacyl-tRNA deacylase | - |
| PVA84_RS23165 (PVA84_23160) | 4682271..4683143 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PVA84_RS23170 (PVA84_23165) | 4683137..4683736 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PVA84_RS23175 (PVA84_23170) | 4683927..4684730 | - | 804 | WP_000059689.1 | DeoR family transcriptional regulator | - |
| PVA84_RS23180 (PVA84_23175) | 4684764..4685660 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12449.38 Da Isoelectric Point: 8.4020
>T274957 WP_000558160.1 NZ_CP120392:4680082-4680393 [Salmonella enterica subsp. enterica serovar Typhi]
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT274957 WP_001259009.1 NZ_CP120392:4680390-4680836 [Salmonella enterica subsp. enterica serovar Typhi]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|