Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3256514..3257079 | Replicon | chromosome |
| Accession | NZ_CP120359 | ||
| Organism | Pseudomonas sp. AA-38 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A9E8XVR8 |
| Locus tag | PVE35_RS14950 | Protein ID | WP_037002684.1 |
| Coordinates | 3256514..3256792 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PVE35_RS14955 | Protein ID | WP_268182864.1 |
| Coordinates | 3256792..3257079 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVE35_RS14920 | 3252016..3252837 | - | 822 | WP_277372252.1 | ABC transporter substrate-binding protein | - |
| PVE35_RS14925 | 3252941..3253837 | + | 897 | WP_277372253.1 | homocysteine S-methyltransferase family protein | - |
| PVE35_RS14930 | 3253891..3254295 | + | 405 | WP_268182871.1 | GNAT family N-acetyltransferase | - |
| PVE35_RS14935 | 3254427..3255464 | + | 1038 | WP_277372254.1 | GGDEF domain-containing protein | - |
| PVE35_RS14940 | 3255461..3255784 | - | 324 | WP_277372255.1 | hypothetical protein | - |
| PVE35_RS14945 | 3255994..3256260 | + | 267 | WP_268182866.1 | hypothetical protein | - |
| PVE35_RS14950 | 3256514..3256792 | + | 279 | WP_037002684.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PVE35_RS14955 | 3256792..3257079 | + | 288 | WP_268182864.1 | HigA family addiction module antitoxin | Antitoxin |
| PVE35_RS14960 | 3257473..3257643 | + | 171 | WP_268182863.1 | YhfG family protein | - |
| PVE35_RS14970 | 3258108..3258944 | - | 837 | WP_277372256.1 | S1-like domain-containing RNA-binding protein | - |
| PVE35_RS14975 | 3259174..3259365 | + | 192 | WP_268182859.1 | hypothetical protein | - |
| PVE35_RS14980 | 3259413..3260507 | - | 1095 | WP_277374890.1 | PQQ-dependent sugar dehydrogenase | - |
| PVE35_RS14985 | 3260633..3261358 | - | 726 | WP_277372257.1 | transporter substrate-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10657.25 Da Isoelectric Point: 9.5915
>T274893 WP_037002684.1 NZ_CP120359:3256514-3256792 [Pseudomonas sp. AA-38]
MIKSFQHKGLRKLFETGSTAGVQPAHAKRLRMQLAALDTAMTVDDMDIPGFRLHPLKGEMRGRWSIMVNGNWRLTFEFRD
GNAYVLDYEDYH
MIKSFQHKGLRKLFETGSTAGVQPAHAKRLRMQLAALDTAMTVDDMDIPGFRLHPLKGEMRGRWSIMVNGNWRLTFEFRD
GNAYVLDYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|