Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 4667742..4668496 Replicon chromosome
Accession NZ_CP120349
Organism Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_1_2021

Toxin (Protein)


Gene name higB Uniprot ID B5F003
Locus tag P1830_RS22835 Protein ID WP_000558166.1
Coordinates 4667742..4668053 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag P1830_RS22840 Protein ID WP_001259012.1
Coordinates 4668050..4668496 (+) Length 149 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1830_RS22805 4663400..4664302 + 903 WP_000331361.1 formate dehydrogenase subunit beta -
P1830_RS22810 4664299..4664934 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
P1830_RS22815 4664931..4665860 + 930 WP_000027730.1 formate dehydrogenase accessory protein FdhE -
P1830_RS22820 4665907..4666197 - 291 WP_000362050.1 DNA-binding transcriptional regulator -
P1830_RS22825 4666198..4666509 - 312 WP_001159630.1 cytotoxic translational repressor of toxin-antitoxin stability system -
P1830_RS22830 4666727..4667656 + 930 WP_021294279.1 alpha/beta hydrolase -
P1830_RS22835 4667742..4668053 + 312 WP_000558166.1 type II toxin-antitoxin system HigB family toxin Toxin
P1830_RS22840 4668050..4668496 + 447 WP_001259012.1 type II toxin-antitoxin system HigA family antitoxin Antitoxin
P1830_RS22845 4668511..4669452 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
P1830_RS22850 4669497..4669934 - 438 WP_001621365.1 D-aminoacyl-tRNA deacylase -
P1830_RS22855 4669931..4670803 - 873 WP_000921423.1 virulence factor BrkB family protein -
P1830_RS22860 4670797..4671396 - 600 WP_000965695.1 glucose-1-phosphatase -
P1830_RS22865 4671587..4672390 - 804 WP_000059693.1 DeoR/GlpR family DNA-binding transcription regulator -
P1830_RS22870 4672424..4673320 - 897 WP_023197766.1 sugar kinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(21-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(93-146)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12432.40 Da        Isoelectric Point: 9.5334

>T274882 WP_000558166.1 NZ_CP120349:4667742-4668053 [Salmonella enterica subsp. enterica serovar Muenchen]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE

Download         Length: 312 bp

Antitoxin


Download         Length: 149 a.a.        Molecular weight: 16750.08 Da        Isoelectric Point: 6.6451

>AT274882 WP_001259012.1 NZ_CP120349:4668050-4668496 [Salmonella enterica subsp. enterica serovar Muenchen]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKSLN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE

Download         Length: 447 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0R9ME90

Antitoxin

Source ID Structure

References