Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4667742..4668496 | Replicon | chromosome |
| Accession | NZ_CP120349 | ||
| Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_1_2021 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | P1830_RS22835 | Protein ID | WP_000558166.1 |
| Coordinates | 4667742..4668053 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P1830_RS22840 | Protein ID | WP_001259012.1 |
| Coordinates | 4668050..4668496 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1830_RS22805 (4663400) | 4663400..4664302 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| P1830_RS22810 (4664299) | 4664299..4664934 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P1830_RS22815 (4664931) | 4664931..4665860 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| P1830_RS22820 (4665907) | 4665907..4666197 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| P1830_RS22825 (4666198) | 4666198..4666509 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| P1830_RS22830 (4666727) | 4666727..4667656 | + | 930 | WP_021294279.1 | alpha/beta hydrolase | - |
| P1830_RS22835 (4667742) | 4667742..4668053 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| P1830_RS22840 (4668050) | 4668050..4668496 | + | 447 | WP_001259012.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| P1830_RS22845 (4668511) | 4668511..4669452 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| P1830_RS22850 (4669497) | 4669497..4669934 | - | 438 | WP_001621365.1 | D-aminoacyl-tRNA deacylase | - |
| P1830_RS22855 (4669931) | 4669931..4670803 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| P1830_RS22860 (4670797) | 4670797..4671396 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| P1830_RS22865 (4671587) | 4671587..4672390 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| P1830_RS22870 (4672424) | 4672424..4673320 | - | 897 | WP_023197766.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T274882 WP_000558166.1 NZ_CP120349:4667742-4668053 [Salmonella enterica subsp. enterica serovar Muenchen]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16750.08 Da Isoelectric Point: 6.6451
>AT274882 WP_001259012.1 NZ_CP120349:4668050-4668496 [Salmonella enterica subsp. enterica serovar Muenchen]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKSLN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKSLN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|