Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4667743..4668497 | Replicon | chromosome |
Accession | NZ_CP120347 | ||
Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_2_2021 |
Toxin (Protein)
Gene name | higB | Uniprot ID | B5F003 |
Locus tag | P1828_RS22855 | Protein ID | WP_000558166.1 |
Coordinates | 4667743..4668054 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | P1828_RS22860 | Protein ID | WP_001259012.1 |
Coordinates | 4668051..4668497 (+) | Length | 149 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1828_RS22825 (4663401) | 4663401..4664303 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
P1828_RS22830 (4664300) | 4664300..4664935 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
P1828_RS22835 (4664932) | 4664932..4665861 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
P1828_RS22840 (4665908) | 4665908..4666198 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
P1828_RS22845 (4666199) | 4666199..4666510 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
P1828_RS22850 (4666728) | 4666728..4667657 | + | 930 | WP_021294279.1 | alpha/beta hydrolase | - |
P1828_RS22855 (4667743) | 4667743..4668054 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
P1828_RS22860 (4668051) | 4668051..4668497 | + | 447 | WP_001259012.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
P1828_RS22865 (4668512) | 4668512..4669453 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
P1828_RS22870 (4669498) | 4669498..4669935 | - | 438 | WP_001621365.1 | D-aminoacyl-tRNA deacylase | - |
P1828_RS22875 (4669932) | 4669932..4670804 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
P1828_RS22880 (4670798) | 4670798..4671397 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
P1828_RS22885 (4671588) | 4671588..4672391 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
P1828_RS22890 (4672425) | 4672425..4673321 | - | 897 | WP_023197766.1 | sugar kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T274864 WP_000558166.1 NZ_CP120347:4667743-4668054 [Salmonella enterica subsp. enterica serovar Muenchen]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16750.08 Da Isoelectric Point: 6.6451
>AT274864 WP_001259012.1 NZ_CP120347:4668051-4668497 [Salmonella enterica subsp. enterica serovar Muenchen]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKSLN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKSLN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|