Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4667584..4668338 | Replicon | chromosome |
| Accession | NZ_CP120335 | ||
| Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_7_2021 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | P1829_RS22845 | Protein ID | WP_000558166.1 |
| Coordinates | 4667584..4667895 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P1829_RS22850 | Protein ID | WP_001259012.1 |
| Coordinates | 4667892..4668338 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1829_RS22815 (4663242) | 4663242..4664144 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| P1829_RS22820 (4664141) | 4664141..4664776 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P1829_RS22825 (4664773) | 4664773..4665702 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| P1829_RS22830 (4665749) | 4665749..4666039 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| P1829_RS22835 (4666040) | 4666040..4666351 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| P1829_RS22840 (4666569) | 4666569..4667498 | + | 930 | WP_021294279.1 | alpha/beta hydrolase | - |
| P1829_RS22845 (4667584) | 4667584..4667895 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| P1829_RS22850 (4667892) | 4667892..4668338 | + | 447 | WP_001259012.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| P1829_RS22855 (4668353) | 4668353..4669294 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| P1829_RS22860 (4669339) | 4669339..4669776 | - | 438 | WP_001621365.1 | D-aminoacyl-tRNA deacylase | - |
| P1829_RS22865 (4669773) | 4669773..4670645 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| P1829_RS22870 (4670639) | 4670639..4671238 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| P1829_RS22875 (4671429) | 4671429..4672232 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| P1829_RS22880 (4672266) | 4672266..4673162 | - | 897 | WP_023197766.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T274762 WP_000558166.1 NZ_CP120335:4667584-4667895 [Salmonella enterica subsp. enterica serovar Muenchen]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16750.08 Da Isoelectric Point: 6.6451
>AT274762 WP_001259012.1 NZ_CP120335:4667892-4668338 [Salmonella enterica subsp. enterica serovar Muenchen]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKSLN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKSLN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|