Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4489967..4490721 | Replicon | chromosome |
| Accession | NZ_CP120329 | ||
| Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_PB_1_2021 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3Z3GAF8 |
| Locus tag | P1707_RS21575 | Protein ID | WP_060598552.1 |
| Coordinates | 4489967..4490278 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P1707_RS21580 | Protein ID | WP_001259012.1 |
| Coordinates | 4490275..4490721 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1707_RS21545 (4485633) | 4485633..4486535 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| P1707_RS21550 (4486532) | 4486532..4487167 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P1707_RS21555 (4487164) | 4487164..4488093 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| P1707_RS21560 (4488131) | 4488131..4488505 | - | 375 | WP_000238494.1 | type II toxin-antitoxin system VapC family toxin | - |
| P1707_RS21565 (4488505) | 4488505..4488747 | - | 243 | WP_001523745.1 | CopG family transcriptional regulator | - |
| P1707_RS21570 (4488952) | 4488952..4489881 | + | 930 | WP_053445360.1 | alpha/beta hydrolase | - |
| P1707_RS21575 (4489967) | 4489967..4490278 | + | 312 | WP_060598552.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| P1707_RS21580 (4490275) | 4490275..4490721 | + | 447 | WP_001259012.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| P1707_RS21585 (4490736) | 4490736..4491677 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| P1707_RS21590 (4491722) | 4491722..4492159 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| P1707_RS21595 (4492156) | 4492156..4493028 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| P1707_RS21600 (4493022) | 4493022..4493621 | - | 600 | WP_000965698.1 | glucose-1-phosphatase | - |
| P1707_RS21605 (4493812) | 4493812..4494615 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| P1707_RS21610 (4494649) | 4494649..4495545 | - | 897 | WP_060598551.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12450.43 Da Isoelectric Point: 9.5334
>T274712 WP_060598552.1 NZ_CP120329:4489967-4490278 [Salmonella enterica subsp. enterica serovar Muenchen]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVMDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVMDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16750.08 Da Isoelectric Point: 6.6451
>AT274712 WP_001259012.1 NZ_CP120329:4490275-4490721 [Salmonella enterica subsp. enterica serovar Muenchen]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKSLN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKSLN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|