Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 656066..656668 | Replicon | chromosome |
| Accession | NZ_CP120327 | ||
| Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_10_2021 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | C0Q3J8 |
| Locus tag | P1825_RS03135 | Protein ID | WP_001159630.1 |
| Coordinates | 656066..656377 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P1825_RS03140 | Protein ID | WP_000362050.1 |
| Coordinates | 656378..656668 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1825_RS03100 (651179) | 651179..651778 | + | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| P1825_RS03105 (651772) | 651772..652644 | + | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| P1825_RS03110 (652641) | 652641..653078 | + | 438 | WP_001621365.1 | D-aminoacyl-tRNA deacylase | - |
| P1825_RS03115 (653123) | 653123..654064 | + | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| P1825_RS03120 (654079) | 654079..654525 | - | 447 | WP_001259012.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| P1825_RS03125 (654522) | 654522..654833 | - | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | - |
| P1825_RS03130 (654919) | 654919..655848 | - | 930 | WP_021294279.1 | alpha/beta hydrolase | - |
| P1825_RS03135 (656066) | 656066..656377 | + | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
| P1825_RS03140 (656378) | 656378..656668 | + | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| P1825_RS03145 (656715) | 656715..657644 | - | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| P1825_RS03150 (657641) | 657641..658276 | - | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P1825_RS03155 (658273) | 658273..659175 | - | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12326.27 Da Isoelectric Point: 9.4460
>T274684 WP_001159630.1 NZ_CP120327:656066-656377 [Salmonella enterica subsp. enterica serovar Muenchen]
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT274684 WP_000362050.1 NZ_CP120327:656378-656668 [Salmonella enterica subsp. enterica serovar Muenchen]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|