Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4665907..4666509 | Replicon | chromosome |
| Accession | NZ_CP120325 | ||
| Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_11_2021 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | C0Q3J8 |
| Locus tag | P1704_RS22840 | Protein ID | WP_001159630.1 |
| Coordinates | 4666198..4666509 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P1704_RS22835 | Protein ID | WP_000362050.1 |
| Coordinates | 4665907..4666197 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1704_RS22820 (4663399) | 4663399..4664301 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| P1704_RS22825 (4664298) | 4664298..4664933 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P1704_RS22830 (4664930) | 4664930..4665859 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| P1704_RS22835 (4665907) | 4665907..4666197 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| P1704_RS22840 (4666198) | 4666198..4666509 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
| P1704_RS22845 (4666727) | 4666727..4667656 | + | 930 | WP_021294279.1 | alpha/beta hydrolase | - |
| P1704_RS22850 (4667742) | 4667742..4668053 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | - |
| P1704_RS22855 (4668050) | 4668050..4668496 | + | 447 | WP_001259012.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| P1704_RS22860 (4668511) | 4668511..4669452 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| P1704_RS22865 (4669497) | 4669497..4669934 | - | 438 | WP_001621365.1 | D-aminoacyl-tRNA deacylase | - |
| P1704_RS22870 (4669931) | 4669931..4670803 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| P1704_RS22875 (4670797) | 4670797..4671396 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12326.27 Da Isoelectric Point: 9.4460
>T274676 WP_001159630.1 NZ_CP120325:c4666509-4666198 [Salmonella enterica subsp. enterica serovar Muenchen]
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT274676 WP_000362050.1 NZ_CP120325:c4666197-4665907 [Salmonella enterica subsp. enterica serovar Muenchen]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|