Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3916321..3916946 | Replicon | chromosome |
Accession | NZ_CP120322 | ||
Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain PS_Ent_1_2022 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | M7SD17 |
Locus tag | P1705_RS19220 | Protein ID | WP_000911336.1 |
Coordinates | 3916321..3916719 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | P1705_RS19225 | Protein ID | WP_000557549.1 |
Coordinates | 3916719..3916946 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1705_RS19205 (3912998) | 3912998..3913579 | - | 582 | WP_001244651.1 | fimbrial protein | - |
P1705_RS19210 (3914298) | 3914298..3914930 | - | 633 | WP_000835265.1 | YfdX family protein | - |
P1705_RS19215 (3914977) | 3914977..3915513 | - | 537 | WP_001038502.1 | STM3031 family outer membrane protein | - |
P1705_RS19220 (3916321) | 3916321..3916719 | - | 399 | WP_000911336.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
P1705_RS19225 (3916719) | 3916719..3916946 | - | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
P1705_RS19230 (3917155) | 3917155..3917406 | + | 252 | WP_001576352.1 | hypothetical protein | - |
P1705_RS19235 (3917686) | 3917686..3918492 | + | 807 | WP_001574939.1 | DUF1460 domain-containing protein | - |
P1705_RS19245 (3918777) | 3918777..3919535 | - | 759 | WP_000244328.1 | amidase activator ActS | - |
P1705_RS19250 (3919800) | 3919800..3920345 | + | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
P1705_RS19255 (3920421) | 3920421..3921939 | - | 1519 | Protein_3725 | lysine--tRNA ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 3907882..3918492 | 10610 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14938.30 Da Isoelectric Point: 7.2155
>T274657 WP_000911336.1 NZ_CP120322:c3916719-3916321 [Salmonella enterica subsp. enterica serovar Enteritidis]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6IFC | |
PDB | 6IFM |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V2Y5V5 |