Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 221507..222261 | Replicon | chromosome |
| Accession | NZ_CP120322 | ||
| Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain PS_Ent_1_2022 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5RFE2 |
| Locus tag | P1705_RS01160 | Protein ID | WP_000558168.1 |
| Coordinates | 221950..222261 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P1705_RS01155 | Protein ID | WP_001259009.1 |
| Coordinates | 221507..221953 (-) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1705_RS01125 (216683) | 216683..217579 | + | 897 | WP_001520529.1 | sugar kinase | - |
| P1705_RS01130 (217613) | 217613..218416 | + | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| P1705_RS01135 (218607) | 218607..219206 | + | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| P1705_RS01140 (219200) | 219200..220072 | + | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| P1705_RS01145 (220069) | 220069..220506 | + | 438 | WP_000560968.1 | D-aminoacyl-tRNA deacylase | - |
| P1705_RS01150 (220551) | 220551..221492 | + | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| P1705_RS01155 (221507) | 221507..221953 | - | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| P1705_RS01160 (221950) | 221950..222261 | - | 312 | WP_000558168.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| P1705_RS01165 (222347) | 222347..223276 | - | 930 | WP_001127705.1 | alpha/beta hydrolase | - |
| P1705_RS01170 (223494) | 223494..223805 | + | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| P1705_RS01175 (223806) | 223806..224096 | + | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| P1705_RS01180 (224143) | 224143..225072 | - | 930 | WP_000027736.1 | formate dehydrogenase accessory protein FdhE | - |
| P1705_RS01185 (225069) | 225069..225704 | - | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P1705_RS01190 (225701) | 225701..226603 | - | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12324.26 Da Isoelectric Point: 9.3143
>T274642 WP_000558168.1 NZ_CP120322:c222261-221950 [Salmonella enterica subsp. enterica serovar Enteritidis]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTLTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTLTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT274642 WP_001259009.1 NZ_CP120322:c221953-221507 [Salmonella enterica subsp. enterica serovar Enteritidis]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|