Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4528770..4529372 | Replicon | chromosome |
| Accession | NZ_CP120318 | ||
| Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain PS_Ent_2_2022 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | M7S4R6 |
| Locus tag | P1703_RS22075 | Protein ID | WP_001159635.1 |
| Coordinates | 4529061..4529372 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P1703_RS22070 | Protein ID | WP_000362050.1 |
| Coordinates | 4528770..4529060 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1703_RS22055 (4526263) | 4526263..4527165 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| P1703_RS22060 (4527162) | 4527162..4527797 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P1703_RS22065 (4527794) | 4527794..4528723 | + | 930 | WP_000027736.1 | formate dehydrogenase accessory protein FdhE | - |
| P1703_RS22070 (4528770) | 4528770..4529060 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| P1703_RS22075 (4529061) | 4529061..4529372 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
| P1703_RS22080 (4529590) | 4529590..4530519 | + | 930 | WP_001127705.1 | alpha/beta hydrolase | - |
| P1703_RS22085 (4530605) | 4530605..4530916 | + | 312 | WP_000558168.1 | type II toxin-antitoxin system HigB family toxin | - |
| P1703_RS22090 (4530913) | 4530913..4531359 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| P1703_RS22095 (4531374) | 4531374..4532315 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| P1703_RS22100 (4532360) | 4532360..4532797 | - | 438 | WP_000560968.1 | D-aminoacyl-tRNA deacylase | - |
| P1703_RS22105 (4532794) | 4532794..4533666 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| P1703_RS22110 (4533660) | 4533660..4534259 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12340.30 Da Isoelectric Point: 9.4460
>T274639 WP_001159635.1 NZ_CP120318:c4529372-4529061 [Salmonella enterica subsp. enterica serovar Enteritidis]
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT274639 WP_000362050.1 NZ_CP120318:c4529060-4528770 [Salmonella enterica subsp. enterica serovar Enteritidis]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|