Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 223911..224175 Replicon plasmid p541822
Accession NZ_CP119983
Organism Salmonella enterica strain CRIN541822

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag P2V99_RS24025 Protein ID WP_001387489.1
Coordinates 223911..224063 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 224115..224175 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P2V99_RS23995 (219177) 219177..221345 + 2169 WP_058649949.1 DotA/TraY family protein -
P2V99_RS24000 (221416) 221416..222078 + 663 WP_000644796.1 plasmid IncI1-type surface exclusion protein ExcA -
P2V99_RS24005 (222150) 222150..222359 - 210 WP_000062603.1 HEAT repeat domain-containing protein -
P2V99_RS24010 (222751) 222751..222927 + 177 WP_001054897.1 hypothetical protein -
P2V99_RS24015 (222992) 222992..223087 - 96 WP_000609148.1 DinQ-like type I toxin DqlB -
P2V99_RS24020 (223588) 223588..223839 + 252 WP_001291964.1 hypothetical protein -
P2V99_RS24025 (223911) 223911..224063 - 153 WP_001387489.1 Hok/Gef family protein Toxin
- (224115) 224115..224175 + 61 NuclAT_0 - Antitoxin
- (224115) 224115..224175 + 61 NuclAT_0 - Antitoxin
- (224115) 224115..224175 + 61 NuclAT_0 - Antitoxin
- (224115) 224115..224175 + 61 NuclAT_0 - Antitoxin
P2V99_RS24030 (224690) 224690..225469 + 780 WP_275450201.1 protein FinQ -
P2V99_RS24035 (225776) 225776..226984 + 1209 WP_001383960.1 IncI1-type conjugal transfer protein TrbA -
P2V99_RS24040 (227003) 227003..228073 + 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid ant(3'')-Ia / qacE / sul1 / tet(A) / blaCTX-M-65 / floR / aph(4)-Ia / aac(3)-IVa / aph(3')-Ia faeC / faeD / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS 1..312171 312171


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T274534 WP_001387489.1 NZ_CP119983:c224063-223911 [Salmonella enterica]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 61 bp

>AT274534 NZ_CP119983:224115-224175 [Salmonella enterica]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References