Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4692009..4692763 | Replicon | chromosome |
| Accession | NZ_CP119982 | ||
| Organism | Salmonella enterica strain CRIN541822 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | P2V99_RS22780 | Protein ID | WP_000558166.1 |
| Coordinates | 4692452..4692763 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P2V99_RS22775 | Protein ID | WP_001259011.1 |
| Coordinates | 4692009..4692455 (-) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P2V99_RS22745 (4687185) | 4687185..4688081 | + | 897 | WP_001520529.1 | sugar kinase | - |
| P2V99_RS22750 (4688115) | 4688115..4688918 | + | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| P2V99_RS22755 (4689109) | 4689109..4689708 | + | 600 | WP_000965698.1 | glucose-1-phosphatase | - |
| P2V99_RS22760 (4689702) | 4689702..4690574 | + | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| P2V99_RS22765 (4690571) | 4690571..4691008 | + | 438 | WP_023993693.1 | D-aminoacyl-tRNA deacylase | - |
| P2V99_RS22770 (4691053) | 4691053..4691994 | + | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| P2V99_RS22775 (4692009) | 4692009..4692455 | - | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| P2V99_RS22780 (4692452) | 4692452..4692763 | - | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| P2V99_RS22785 (4692849) | 4692849..4693778 | - | 930 | WP_021294279.1 | alpha/beta hydrolase | - |
| P2V99_RS22790 (4693996) | 4693996..4694307 | + | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| P2V99_RS22795 (4694308) | 4694308..4694598 | + | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| P2V99_RS22800 (4694645) | 4694645..4695574 | - | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| P2V99_RS22805 (4695571) | 4695571..4696206 | - | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P2V99_RS22810 (4696203) | 4696203..4697105 | - | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T274528 WP_000558166.1 NZ_CP119982:c4692763-4692452 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT274528 WP_001259011.1 NZ_CP119982:c4692455-4692009 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|