Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 4422974..4423706 | Replicon | chromosome |
Accession | NZ_CP119869 | ||
Organism | Methylosinus trichosporium OB3b |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A1A6FRG6 |
Locus tag | P3C36_RS20905 | Protein ID | WP_003615036.1 |
Coordinates | 4422974..4423252 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A1A6FTV8 |
Locus tag | P3C36_RS20910 | Protein ID | WP_003615038.1 |
Coordinates | 4423380..4423706 (+) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P3C36_RS20885 | 4418549..4419724 | + | 1176 | WP_024749364.1 | IS4 family transposase | - |
P3C36_RS20890 | 4419774..4421078 | - | 1305 | WP_003615029.1 | folylpolyglutamate synthase/dihydrofolate synthase family protein | - |
P3C36_RS20895 | 4421098..4421958 | - | 861 | WP_003615033.1 | acetyl-CoA carboxylase, carboxyltransferase subunit beta | - |
P3C36_RS20900 | 4421955..4422857 | - | 903 | WP_003615034.1 | tryptophan synthase subunit alpha | - |
P3C36_RS20905 | 4422974..4423252 | + | 279 | WP_003615036.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P3C36_RS20910 | 4423380..4423706 | + | 327 | WP_003615038.1 | HigA family addiction module antitoxin | Antitoxin |
P3C36_RS20915 | 4423715..4424605 | - | 891 | WP_003615039.1 | LysR substrate-binding domain-containing protein | - |
P3C36_RS20920 | 4424716..4425168 | + | 453 | WP_003615041.1 | cupin domain-containing protein | - |
P3C36_RS20925 | 4425177..4426076 | + | 900 | WP_003615043.1 | dihydrodipicolinate synthase family protein | - |
P3C36_RS20930 | 4426191..4426931 | + | 741 | WP_003615045.1 | sulfite exporter TauE/SafE family protein | - |
P3C36_RS20935 | 4427045..4427257 | + | 213 | WP_155931257.1 | hypothetical protein | - |
P3C36_RS20940 | 4427305..4427955 | + | 651 | WP_003615048.1 | Fic family protein | - |
P3C36_RS20945 | 4428025..4428381 | + | 357 | WP_003615049.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10329.69 Da Isoelectric Point: 7.2044
>T274483 WP_003615036.1 NZ_CP119869:4422974-4423252 [Methylosinus trichosporium OB3b]
MIRSVKGTVTRQFVETGKSKFSGLDEALARQRLAELDSAASLDDLPPLRSVGLHRLSGDRKGQWAIKVNGPWRIAFRFED
GDAFEVEIVDYH
MIRSVKGTVTRQFVETGKSKFSGLDEALARQRLAELDSAASLDDLPPLRSVGLHRLSGDRKGQWAIKVNGPWRIAFRFED
GDAFEVEIVDYH
Download Length: 279 bp
Antitoxin
Download Length: 109 a.a. Molecular weight: 11696.42 Da Isoelectric Point: 10.2107
>AT274483 WP_003615038.1 NZ_CP119869:4423380-4423706 [Methylosinus trichosporium OB3b]
MTTKSADIFEAPPGGFRFGPIHPGRTLAAELKARGISAHALALSLRVPANRISEIVAGKRGVTAETALRLARYLGTSAAF
WMNLQSKYDLEIAERDFGERIRAEVEAA
MTTKSADIFEAPPGGFRFGPIHPGRTLAAELKARGISAHALALSLRVPANRISEIVAGKRGVTAETALRLARYLGTSAAF
WMNLQSKYDLEIAERDFGERIRAEVEAA
Download Length: 327 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1A6FRG6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1A6FTV8 |