Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_31 |
Location | 1475212..1475813 | Replicon | chromosome |
Accession | NZ_CP119869 | ||
Organism | Methylosinus trichosporium OB3b |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | P3C36_RS06940 | Protein ID | WP_003615898.1 |
Coordinates | 1475490..1475813 (-) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A1A6FQK6 |
Locus tag | P3C36_RS06935 | Protein ID | WP_003615896.1 |
Coordinates | 1475212..1475493 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P3C36_RS06900 | 1470248..1470625 | - | 378 | WP_003613712.1 | transposase | - |
P3C36_RS06905 | 1471213..1471575 | + | 363 | WP_051418692.1 | transposase | - |
P3C36_RS06910 | 1471572..1471919 | + | 348 | WP_024749862.1 | IS66 family insertion sequence element accessory protein TnpB | - |
P3C36_RS06915 | 1471988..1473598 | + | 1611 | WP_003616133.1 | IS66 family transposase | - |
P3C36_RS06920 | 1473601..1473834 | + | 234 | WP_003616132.1 | hypothetical protein | - |
P3C36_RS06925 | 1473871..1474216 | + | 346 | Protein_1352 | IS21 family transposase | - |
P3C36_RS06930 | 1474149..1474877 | + | 729 | WP_024749851.1 | IS21-like element helper ATPase IstB | - |
P3C36_RS06935 | 1475212..1475493 | - | 282 | WP_003615896.1 | helix-turn-helix transcriptional regulator | Antitoxin |
P3C36_RS06940 | 1475490..1475813 | - | 324 | WP_003615898.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P3C36_RS06945 | 1476145..1477503 | + | 1359 | WP_283471814.1 | SNF2-related protein | - |
P3C36_RS06950 | 1477503..1478993 | + | 1491 | WP_283471816.1 | helicase-related protein | - |
P3C36_RS06955 | 1479067..1479348 | - | 282 | Protein_1358 | IS3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1474149..1478993 | 4844 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12084.25 Da Isoelectric Point: 10.8882
>T274478 WP_003615898.1 NZ_CP119869:c1475813-1475490 [Methylosinus trichosporium OB3b]
MAWRVEILNETVVAEIAALPADMQARFLRLAERINSAGLESLSEPHVKHLEGKLWELRLTGRDGIARALYVTTVGRKVVV
LRAFVKKTQKTPRAEIELALRRAKEVI
MAWRVEILNETVVAEIAALPADMQARFLRLAERINSAGLESLSEPHVKHLEGKLWELRLTGRDGIARALYVTTVGRKVVV
LRAFVKKTQKTPRAEIELALRRAKEVI
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|