Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2473947..2474509 | Replicon | chromosome |
| Accession | NZ_CP119862 | ||
| Organism | Citrobacter sp. S171 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | P2W74_RS12065 | Protein ID | WP_276295183.1 |
| Coordinates | 2474228..2474509 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P2W74_RS12060 | Protein ID | WP_276291761.1 |
| Coordinates | 2473947..2474231 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P2W74_RS12045 (2471873) | 2471873..2472757 | + | 885 | WP_192612223.1 | formate dehydrogenase N subunit beta | - |
| P2W74_RS12050 (2472750) | 2472750..2473403 | + | 654 | WP_162382270.1 | formate dehydrogenase-N subunit gamma | - |
| P2W74_RS12055 (2473476) | 2473476..2473946 | + | 471 | WP_276291760.1 | NUDIX domain-containing protein | - |
| P2W74_RS12060 (2473947) | 2473947..2474231 | - | 285 | WP_276291761.1 | HigA family addiction module antitoxin | Antitoxin |
| P2W74_RS12065 (2474228) | 2474228..2474509 | - | 282 | WP_276295183.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P2W74_RS12070 (2474695) | 2474695..2475705 | - | 1011 | WP_276291762.1 | alcohol dehydrogenase AdhP | - |
| P2W74_RS12075 (2475944) | 2475944..2477662 | - | 1719 | WP_276291763.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10670.17 Da Isoelectric Point: 7.4728
>T274465 WP_276295183.1 NZ_CP119862:c2474509-2474228 [Citrobacter sp. S171]
MIMSFRHKGLRDLFLHGRTSGVLATQVKRLRHRLAVIDAACHINDIDMPGYRLHPLSGDRDGVWAISVSGNWRITFEFVN
GDAYLLDYEDYHA
MIMSFRHKGLRDLFLHGRTSGVLATQVKRLRHRLAVIDAACHINDIDMPGYRLHPLSGDRDGVWAISVSGNWRITFEFVN
GDAYLLDYEDYHA
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|