Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 39579..40229 | Replicon | chromosome |
| Accession | NZ_CP119862 | ||
| Organism | Citrobacter sp. S171 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | P2W74_RS00190 | Protein ID | WP_276293437.1 |
| Coordinates | 39579..39920 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P2W74_RS00195 | Protein ID | WP_276293438.1 |
| Coordinates | 39930..40229 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P2W74_RS00175 (35512) | 35512..37287 | - | 1776 | WP_276293434.1 | adenine deaminase | - |
| P2W74_RS00180 (37464) | 37464..38798 | + | 1335 | WP_276293435.1 | NCS2 family permease | - |
| P2W74_RS00185 (38851) | 38851..39303 | + | 453 | WP_276293436.1 | DUF1198 domain-containing protein | - |
| P2W74_RS00190 (39579) | 39579..39920 | + | 342 | WP_276293437.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P2W74_RS00195 (39930) | 39930..40229 | + | 300 | WP_276293438.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| P2W74_RS00200 (40350) | 40350..41546 | + | 1197 | WP_276293439.1 | purine ribonucleoside efflux pump NepI | - |
| P2W74_RS00205 (41600) | 41600..42916 | - | 1317 | WP_276293440.1 | MFS transporter | - |
| P2W74_RS00210 (42981) | 42981..43838 | - | 858 | WP_276293441.1 | arabinose operon transcriptional regulator AraC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13072.81 Da Isoelectric Point: 5.1962
>T274461 WP_276293437.1 NZ_CP119862:39579-39920 [Citrobacter sp. S171]
MWDVETTDAFDRWFDEQTEALKEDMLAAMMILSEYGPQLGRPFADTVNDSAFSNMKELRVQHQGSPIRAFFAFDPSRHGI
VLCAGDKTGLNEKKFYKDMIKFADAEYRKHLNK
MWDVETTDAFDRWFDEQTEALKEDMLAAMMILSEYGPQLGRPFADTVNDSAFSNMKELRVQHQGSPIRAFFAFDPSRHGI
VLCAGDKTGLNEKKFYKDMIKFADAEYRKHLNK
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|