Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 4436410..4437093 | Replicon | chromosome |
| Accession | NZ_CP119754 | ||
| Organism | Superficieibacter sp. HKU1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | P0H77_RS21150 | Protein ID | WP_276159131.1 |
| Coordinates | 4436776..4437093 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P0H77_RS21145 | Protein ID | WP_276159130.1 |
| Coordinates | 4436410..4436706 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0H77_RS21125 (P0H77_21130) | 4432268..4433674 | - | 1407 | WP_176920893.1 | replicative DNA helicase | - |
| P0H77_RS21130 (P0H77_21135) | 4433738..4434721 | + | 984 | WP_276159127.1 | quinone oxidoreductase | - |
| P0H77_RS21135 (P0H77_21140) | 4434886..4435128 | - | 243 | WP_276159128.1 | envelope stress response protein PspG | - |
| P0H77_RS21140 (P0H77_21145) | 4435264..4436274 | - | 1011 | WP_276159129.1 | tRNA dihydrouridine(20/20a) synthase DusA | - |
| P0H77_RS21145 (P0H77_21150) | 4436410..4436706 | - | 297 | WP_276159130.1 | NadS family protein | Antitoxin |
| P0H77_RS21150 (P0H77_21155) | 4436776..4437093 | - | 318 | WP_276159131.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P0H77_RS21155 (P0H77_21160) | 4437325..4437837 | + | 513 | WP_276159132.1 | zinc uptake transcriptional repressor Zur | - |
| P0H77_RS21160 (P0H77_21165) | 4437917..4438126 | - | 210 | WP_176920900.1 | CsbD family protein | - |
| P0H77_RS21165 (P0H77_21170) | 4438342..4438950 | - | 609 | WP_276159133.1 | transcriptional repressor LexA | - |
| P0H77_RS21170 (P0H77_21175) | 4439060..4439428 | - | 369 | WP_276159134.1 | diacylglycerol kinase | - |
| P0H77_RS21175 (P0H77_21180) | 4439558..4441978 | + | 2421 | WP_276159135.1 | glycerol-3-phosphate 1-O-acyltransferase PlsB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12228.09 Da Isoelectric Point: 9.8034
>T274436 WP_276159131.1 NZ_CP119754:c4437093-4436776 [Superficieibacter sp. HKU1]
MFTFIELHGFSKRRQAFLPDDEFRVFQELLIEDPETGDVIAGTGGFRKIRWSRPGMGKRGGVRVIYYTVTRKGRIYLALI
YPKNEQDDLSEDQKRALKQLSDMLV
MFTFIELHGFSKRRQAFLPDDEFRVFQELLIEDPETGDVIAGTGGFRKIRWSRPGMGKRGGVRVIYYTVTRKGRIYLALI
YPKNEQDDLSEDQKRALKQLSDMLV
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|