Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4779086..4779688 | Replicon | chromosome |
| Accession | NZ_CP119746 | ||
| Organism | Escherichia coli strain E15 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | P1J19_RS23125 | Protein ID | WP_001593848.1 |
| Coordinates | 4779377..4779688 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P1J19_RS23120 | Protein ID | WP_000356397.1 |
| Coordinates | 4779086..4779376 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1J19_RS23095 (4775031) | 4775031..4775933 | + | 903 | WP_169759669.1 | formate dehydrogenase O subunit beta | - |
| P1J19_RS23100 (4775930) | 4775930..4776565 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P1J19_RS23105 (4776562) | 4776562..4777491 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| P1J19_RS23110 (4777821) | 4777821..4778063 | - | 243 | WP_001087409.1 | protein YiiF | - |
| P1J19_RS23115 (4778282) | 4778282..4778500 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| P1J19_RS23120 (4779086) | 4779086..4779376 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| P1J19_RS23125 (4779377) | 4779377..4779688 | - | 312 | WP_001593848.1 | hypothetical protein | Toxin |
| P1J19_RS23130 (4779917) | 4779917..4780810 | + | 894 | WP_276169778.1 | alpha/beta hydrolase | - |
| P1J19_RS23135 (4780889) | 4780889..4781830 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| P1J19_RS23140 (4781875) | 4781875..4782312 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| P1J19_RS23145 (4782309) | 4782309..4783181 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| P1J19_RS23150 (4783175) | 4783175..4783774 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12174.15 Da Isoelectric Point: 9.7791
>T274408 WP_001593848.1 NZ_CP119746:c4779688-4779377 [Escherichia coli]
MLFIETEIFTEDVQKPLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKPLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|