Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
| Location | 1476305..1476526 | Replicon | chromosome |
| Accession | NC_017641 | ||
| Organism | Escherichia coli UMNK88 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | E3PKK3 |
| Locus tag | UMNK88_RS07545 | Protein ID | WP_000170951.1 |
| Coordinates | 1476305..1476412 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 1476460..1476526 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| UMNK88_RS07520 | 1472151..1473233 | + | 1083 | WP_000804723.1 | peptide chain release factor 1 | - |
| UMNK88_RS07525 | 1473233..1474066 | + | 834 | WP_000456454.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| UMNK88_RS07530 | 1474063..1474455 | + | 393 | WP_000200373.1 | invasion regulator SirB2 | - |
| UMNK88_RS07535 | 1474459..1475268 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| UMNK88_RS07540 | 1475304..1476158 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| UMNK88_RS07545 | 1476305..1476412 | - | 108 | WP_000170951.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1476460..1476526 | + | 67 | NuclAT_12 | - | Antitoxin |
| - | 1476460..1476526 | + | 67 | NuclAT_12 | - | Antitoxin |
| - | 1476460..1476526 | + | 67 | NuclAT_12 | - | Antitoxin |
| - | 1476460..1476526 | + | 67 | NuclAT_12 | - | Antitoxin |
| - | 1476460..1476526 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1476460..1476526 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1476460..1476526 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1476460..1476526 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1476460..1476526 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1476460..1476526 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1476460..1476526 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1476460..1476526 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1476460..1476526 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1476460..1476526 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1476460..1476526 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1476460..1476526 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1476460..1476526 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1476460..1476526 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1476460..1476526 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1476460..1476526 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1476460..1476526 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 1476460..1476526 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 1476460..1476526 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 1476460..1476526 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 1476462..1476525 | + | 64 | NuclAT_27 | - | - |
| - | 1476462..1476525 | + | 64 | NuclAT_27 | - | - |
| - | 1476462..1476525 | + | 64 | NuclAT_27 | - | - |
| - | 1476462..1476525 | + | 64 | NuclAT_27 | - | - |
| - | 1476462..1476525 | + | 64 | NuclAT_30 | - | - |
| - | 1476462..1476525 | + | 64 | NuclAT_30 | - | - |
| - | 1476462..1476525 | + | 64 | NuclAT_30 | - | - |
| - | 1476462..1476525 | + | 64 | NuclAT_30 | - | - |
| - | 1476462..1476525 | + | 64 | NuclAT_33 | - | - |
| - | 1476462..1476525 | + | 64 | NuclAT_33 | - | - |
| - | 1476462..1476525 | + | 64 | NuclAT_33 | - | - |
| - | 1476462..1476525 | + | 64 | NuclAT_33 | - | - |
| - | 1476462..1476525 | + | 64 | NuclAT_36 | - | - |
| - | 1476462..1476525 | + | 64 | NuclAT_36 | - | - |
| - | 1476462..1476525 | + | 64 | NuclAT_36 | - | - |
| - | 1476462..1476525 | + | 64 | NuclAT_36 | - | - |
| - | 1476462..1476525 | + | 64 | NuclAT_40 | - | - |
| - | 1476462..1476525 | + | 64 | NuclAT_40 | - | - |
| - | 1476462..1476525 | + | 64 | NuclAT_40 | - | - |
| - | 1476462..1476525 | + | 64 | NuclAT_40 | - | - |
| - | 1476462..1476525 | + | 64 | NuclAT_43 | - | - |
| - | 1476462..1476525 | + | 64 | NuclAT_43 | - | - |
| - | 1476462..1476525 | + | 64 | NuclAT_43 | - | - |
| - | 1476462..1476525 | + | 64 | NuclAT_43 | - | - |
| - | 1476462..1476527 | + | 66 | NuclAT_46 | - | - |
| - | 1476462..1476527 | + | 66 | NuclAT_46 | - | - |
| - | 1476462..1476527 | + | 66 | NuclAT_46 | - | - |
| - | 1476462..1476527 | + | 66 | NuclAT_46 | - | - |
| UMNK88_RS07550 | 1476840..1476947 | - | 108 | WP_000170963.1 | small toxic polypeptide LdrB | - |
| - | 1476995..1477060 | + | 66 | NuclAT_25 | - | - |
| - | 1476995..1477060 | + | 66 | NuclAT_25 | - | - |
| - | 1476995..1477060 | + | 66 | NuclAT_25 | - | - |
| - | 1476995..1477060 | + | 66 | NuclAT_25 | - | - |
| - | 1476995..1477060 | + | 66 | NuclAT_28 | - | - |
| - | 1476995..1477060 | + | 66 | NuclAT_28 | - | - |
| - | 1476995..1477060 | + | 66 | NuclAT_28 | - | - |
| - | 1476995..1477060 | + | 66 | NuclAT_28 | - | - |
| - | 1476995..1477060 | + | 66 | NuclAT_31 | - | - |
| - | 1476995..1477060 | + | 66 | NuclAT_31 | - | - |
| - | 1476995..1477060 | + | 66 | NuclAT_31 | - | - |
| - | 1476995..1477060 | + | 66 | NuclAT_31 | - | - |
| - | 1476995..1477060 | + | 66 | NuclAT_34 | - | - |
| - | 1476995..1477060 | + | 66 | NuclAT_34 | - | - |
| - | 1476995..1477060 | + | 66 | NuclAT_34 | - | - |
| - | 1476995..1477060 | + | 66 | NuclAT_34 | - | - |
| - | 1476995..1477060 | + | 66 | NuclAT_38 | - | - |
| - | 1476995..1477060 | + | 66 | NuclAT_38 | - | - |
| - | 1476995..1477060 | + | 66 | NuclAT_38 | - | - |
| - | 1476995..1477060 | + | 66 | NuclAT_38 | - | - |
| - | 1476995..1477060 | + | 66 | NuclAT_41 | - | - |
| - | 1476995..1477060 | + | 66 | NuclAT_41 | - | - |
| - | 1476995..1477060 | + | 66 | NuclAT_41 | - | - |
| - | 1476995..1477060 | + | 66 | NuclAT_41 | - | - |
| - | 1476995..1477062 | + | 68 | NuclAT_44 | - | - |
| - | 1476995..1477062 | + | 68 | NuclAT_44 | - | - |
| - | 1476995..1477062 | + | 68 | NuclAT_44 | - | - |
| - | 1476995..1477062 | + | 68 | NuclAT_44 | - | - |
| - | 1476996..1477061 | + | 66 | NuclAT_13 | - | - |
| - | 1476996..1477061 | + | 66 | NuclAT_13 | - | - |
| - | 1476996..1477061 | + | 66 | NuclAT_13 | - | - |
| - | 1476996..1477061 | + | 66 | NuclAT_13 | - | - |
| - | 1476996..1477061 | + | 66 | NuclAT_15 | - | - |
| - | 1476996..1477061 | + | 66 | NuclAT_15 | - | - |
| - | 1476996..1477061 | + | 66 | NuclAT_15 | - | - |
| - | 1476996..1477061 | + | 66 | NuclAT_15 | - | - |
| - | 1476996..1477061 | + | 66 | NuclAT_17 | - | - |
| - | 1476996..1477061 | + | 66 | NuclAT_17 | - | - |
| - | 1476996..1477061 | + | 66 | NuclAT_17 | - | - |
| - | 1476996..1477061 | + | 66 | NuclAT_17 | - | - |
| - | 1476996..1477061 | + | 66 | NuclAT_19 | - | - |
| - | 1476996..1477061 | + | 66 | NuclAT_19 | - | - |
| - | 1476996..1477061 | + | 66 | NuclAT_19 | - | - |
| - | 1476996..1477061 | + | 66 | NuclAT_19 | - | - |
| - | 1476996..1477061 | + | 66 | NuclAT_21 | - | - |
| - | 1476996..1477061 | + | 66 | NuclAT_21 | - | - |
| - | 1476996..1477061 | + | 66 | NuclAT_21 | - | - |
| - | 1476996..1477061 | + | 66 | NuclAT_21 | - | - |
| - | 1476996..1477061 | + | 66 | NuclAT_23 | - | - |
| - | 1476996..1477061 | + | 66 | NuclAT_23 | - | - |
| - | 1476996..1477061 | + | 66 | NuclAT_23 | - | - |
| - | 1476996..1477061 | + | 66 | NuclAT_23 | - | - |
| UMNK88_RS07555 | 1477375..1477482 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1477530..1477595 | + | 66 | NuclAT_26 | - | - |
| - | 1477530..1477595 | + | 66 | NuclAT_26 | - | - |
| - | 1477530..1477595 | + | 66 | NuclAT_26 | - | - |
| - | 1477530..1477595 | + | 66 | NuclAT_26 | - | - |
| - | 1477530..1477595 | + | 66 | NuclAT_29 | - | - |
| - | 1477530..1477595 | + | 66 | NuclAT_29 | - | - |
| - | 1477530..1477595 | + | 66 | NuclAT_29 | - | - |
| - | 1477530..1477595 | + | 66 | NuclAT_29 | - | - |
| - | 1477530..1477595 | + | 66 | NuclAT_32 | - | - |
| - | 1477530..1477595 | + | 66 | NuclAT_32 | - | - |
| - | 1477530..1477595 | + | 66 | NuclAT_32 | - | - |
| - | 1477530..1477595 | + | 66 | NuclAT_32 | - | - |
| - | 1477530..1477595 | + | 66 | NuclAT_35 | - | - |
| - | 1477530..1477595 | + | 66 | NuclAT_35 | - | - |
| - | 1477530..1477595 | + | 66 | NuclAT_35 | - | - |
| - | 1477530..1477595 | + | 66 | NuclAT_35 | - | - |
| - | 1477530..1477595 | + | 66 | NuclAT_39 | - | - |
| - | 1477530..1477595 | + | 66 | NuclAT_39 | - | - |
| - | 1477530..1477595 | + | 66 | NuclAT_39 | - | - |
| - | 1477530..1477595 | + | 66 | NuclAT_39 | - | - |
| - | 1477530..1477595 | + | 66 | NuclAT_42 | - | - |
| - | 1477530..1477595 | + | 66 | NuclAT_42 | - | - |
| - | 1477530..1477595 | + | 66 | NuclAT_42 | - | - |
| - | 1477530..1477595 | + | 66 | NuclAT_42 | - | - |
| - | 1477530..1477597 | + | 68 | NuclAT_45 | - | - |
| - | 1477530..1477597 | + | 68 | NuclAT_45 | - | - |
| - | 1477530..1477597 | + | 68 | NuclAT_45 | - | - |
| - | 1477530..1477597 | + | 68 | NuclAT_45 | - | - |
| UMNK88_RS07560 | 1477887..1478987 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| UMNK88_RS07565 | 1479257..1479487 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| UMNK88_RS07570 | 1479645..1480340 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| UMNK88_RS07575 | 1480384..1480737 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3961.74 Da Isoelectric Point: 9.1413
>T27440 WP_000170951.1 NC_017641:c1476412-1476305 [Escherichia coli UMNK88]
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T27440 NC_017641:c1476412-1476305 [Escherichia coli UMNK88]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGGACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGGACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT27440 NC_017641:1476460-1476526 [Escherichia coli UMNK88]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|