Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 1476305..1476526 Replicon chromosome
Accession NC_017641
Organism Escherichia coli UMNK88

Toxin (Protein)


Gene name ldrD Uniprot ID E3PKK3
Locus tag UMNK88_RS07545 Protein ID WP_000170951.1
Coordinates 1476305..1476412 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 1476460..1476526 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
UMNK88_RS07520 1472151..1473233 + 1083 WP_000804723.1 peptide chain release factor 1 -
UMNK88_RS07525 1473233..1474066 + 834 WP_000456454.1 peptide chain release factor N(5)-glutamine methyltransferase -
UMNK88_RS07530 1474063..1474455 + 393 WP_000200373.1 invasion regulator SirB2 -
UMNK88_RS07535 1474459..1475268 + 810 WP_001257044.1 invasion regulator SirB1 -
UMNK88_RS07540 1475304..1476158 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
UMNK88_RS07545 1476305..1476412 - 108 WP_000170951.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1476460..1476526 + 67 NuclAT_12 - Antitoxin
- 1476460..1476526 + 67 NuclAT_12 - Antitoxin
- 1476460..1476526 + 67 NuclAT_12 - Antitoxin
- 1476460..1476526 + 67 NuclAT_12 - Antitoxin
- 1476460..1476526 + 67 NuclAT_14 - Antitoxin
- 1476460..1476526 + 67 NuclAT_14 - Antitoxin
- 1476460..1476526 + 67 NuclAT_14 - Antitoxin
- 1476460..1476526 + 67 NuclAT_14 - Antitoxin
- 1476460..1476526 + 67 NuclAT_16 - Antitoxin
- 1476460..1476526 + 67 NuclAT_16 - Antitoxin
- 1476460..1476526 + 67 NuclAT_16 - Antitoxin
- 1476460..1476526 + 67 NuclAT_16 - Antitoxin
- 1476460..1476526 + 67 NuclAT_18 - Antitoxin
- 1476460..1476526 + 67 NuclAT_18 - Antitoxin
- 1476460..1476526 + 67 NuclAT_18 - Antitoxin
- 1476460..1476526 + 67 NuclAT_18 - Antitoxin
- 1476460..1476526 + 67 NuclAT_20 - Antitoxin
- 1476460..1476526 + 67 NuclAT_20 - Antitoxin
- 1476460..1476526 + 67 NuclAT_20 - Antitoxin
- 1476460..1476526 + 67 NuclAT_20 - Antitoxin
- 1476460..1476526 + 67 NuclAT_22 - Antitoxin
- 1476460..1476526 + 67 NuclAT_22 - Antitoxin
- 1476460..1476526 + 67 NuclAT_22 - Antitoxin
- 1476460..1476526 + 67 NuclAT_22 - Antitoxin
- 1476462..1476525 + 64 NuclAT_27 - -
- 1476462..1476525 + 64 NuclAT_27 - -
- 1476462..1476525 + 64 NuclAT_27 - -
- 1476462..1476525 + 64 NuclAT_27 - -
- 1476462..1476525 + 64 NuclAT_30 - -
- 1476462..1476525 + 64 NuclAT_30 - -
- 1476462..1476525 + 64 NuclAT_30 - -
- 1476462..1476525 + 64 NuclAT_30 - -
- 1476462..1476525 + 64 NuclAT_33 - -
- 1476462..1476525 + 64 NuclAT_33 - -
- 1476462..1476525 + 64 NuclAT_33 - -
- 1476462..1476525 + 64 NuclAT_33 - -
- 1476462..1476525 + 64 NuclAT_36 - -
- 1476462..1476525 + 64 NuclAT_36 - -
- 1476462..1476525 + 64 NuclAT_36 - -
- 1476462..1476525 + 64 NuclAT_36 - -
- 1476462..1476525 + 64 NuclAT_40 - -
- 1476462..1476525 + 64 NuclAT_40 - -
- 1476462..1476525 + 64 NuclAT_40 - -
- 1476462..1476525 + 64 NuclAT_40 - -
- 1476462..1476525 + 64 NuclAT_43 - -
- 1476462..1476525 + 64 NuclAT_43 - -
- 1476462..1476525 + 64 NuclAT_43 - -
- 1476462..1476525 + 64 NuclAT_43 - -
- 1476462..1476527 + 66 NuclAT_46 - -
- 1476462..1476527 + 66 NuclAT_46 - -
- 1476462..1476527 + 66 NuclAT_46 - -
- 1476462..1476527 + 66 NuclAT_46 - -
UMNK88_RS07550 1476840..1476947 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 1476995..1477060 + 66 NuclAT_25 - -
- 1476995..1477060 + 66 NuclAT_25 - -
- 1476995..1477060 + 66 NuclAT_25 - -
- 1476995..1477060 + 66 NuclAT_25 - -
- 1476995..1477060 + 66 NuclAT_28 - -
- 1476995..1477060 + 66 NuclAT_28 - -
- 1476995..1477060 + 66 NuclAT_28 - -
- 1476995..1477060 + 66 NuclAT_28 - -
- 1476995..1477060 + 66 NuclAT_31 - -
- 1476995..1477060 + 66 NuclAT_31 - -
- 1476995..1477060 + 66 NuclAT_31 - -
- 1476995..1477060 + 66 NuclAT_31 - -
- 1476995..1477060 + 66 NuclAT_34 - -
- 1476995..1477060 + 66 NuclAT_34 - -
- 1476995..1477060 + 66 NuclAT_34 - -
- 1476995..1477060 + 66 NuclAT_34 - -
- 1476995..1477060 + 66 NuclAT_38 - -
- 1476995..1477060 + 66 NuclAT_38 - -
- 1476995..1477060 + 66 NuclAT_38 - -
- 1476995..1477060 + 66 NuclAT_38 - -
- 1476995..1477060 + 66 NuclAT_41 - -
- 1476995..1477060 + 66 NuclAT_41 - -
- 1476995..1477060 + 66 NuclAT_41 - -
- 1476995..1477060 + 66 NuclAT_41 - -
- 1476995..1477062 + 68 NuclAT_44 - -
- 1476995..1477062 + 68 NuclAT_44 - -
- 1476995..1477062 + 68 NuclAT_44 - -
- 1476995..1477062 + 68 NuclAT_44 - -
- 1476996..1477061 + 66 NuclAT_13 - -
- 1476996..1477061 + 66 NuclAT_13 - -
- 1476996..1477061 + 66 NuclAT_13 - -
- 1476996..1477061 + 66 NuclAT_13 - -
- 1476996..1477061 + 66 NuclAT_15 - -
- 1476996..1477061 + 66 NuclAT_15 - -
- 1476996..1477061 + 66 NuclAT_15 - -
- 1476996..1477061 + 66 NuclAT_15 - -
- 1476996..1477061 + 66 NuclAT_17 - -
- 1476996..1477061 + 66 NuclAT_17 - -
- 1476996..1477061 + 66 NuclAT_17 - -
- 1476996..1477061 + 66 NuclAT_17 - -
- 1476996..1477061 + 66 NuclAT_19 - -
- 1476996..1477061 + 66 NuclAT_19 - -
- 1476996..1477061 + 66 NuclAT_19 - -
- 1476996..1477061 + 66 NuclAT_19 - -
- 1476996..1477061 + 66 NuclAT_21 - -
- 1476996..1477061 + 66 NuclAT_21 - -
- 1476996..1477061 + 66 NuclAT_21 - -
- 1476996..1477061 + 66 NuclAT_21 - -
- 1476996..1477061 + 66 NuclAT_23 - -
- 1476996..1477061 + 66 NuclAT_23 - -
- 1476996..1477061 + 66 NuclAT_23 - -
- 1476996..1477061 + 66 NuclAT_23 - -
UMNK88_RS07555 1477375..1477482 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1477530..1477595 + 66 NuclAT_26 - -
- 1477530..1477595 + 66 NuclAT_26 - -
- 1477530..1477595 + 66 NuclAT_26 - -
- 1477530..1477595 + 66 NuclAT_26 - -
- 1477530..1477595 + 66 NuclAT_29 - -
- 1477530..1477595 + 66 NuclAT_29 - -
- 1477530..1477595 + 66 NuclAT_29 - -
- 1477530..1477595 + 66 NuclAT_29 - -
- 1477530..1477595 + 66 NuclAT_32 - -
- 1477530..1477595 + 66 NuclAT_32 - -
- 1477530..1477595 + 66 NuclAT_32 - -
- 1477530..1477595 + 66 NuclAT_32 - -
- 1477530..1477595 + 66 NuclAT_35 - -
- 1477530..1477595 + 66 NuclAT_35 - -
- 1477530..1477595 + 66 NuclAT_35 - -
- 1477530..1477595 + 66 NuclAT_35 - -
- 1477530..1477595 + 66 NuclAT_39 - -
- 1477530..1477595 + 66 NuclAT_39 - -
- 1477530..1477595 + 66 NuclAT_39 - -
- 1477530..1477595 + 66 NuclAT_39 - -
- 1477530..1477595 + 66 NuclAT_42 - -
- 1477530..1477595 + 66 NuclAT_42 - -
- 1477530..1477595 + 66 NuclAT_42 - -
- 1477530..1477595 + 66 NuclAT_42 - -
- 1477530..1477597 + 68 NuclAT_45 - -
- 1477530..1477597 + 68 NuclAT_45 - -
- 1477530..1477597 + 68 NuclAT_45 - -
- 1477530..1477597 + 68 NuclAT_45 - -
UMNK88_RS07560 1477887..1478987 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
UMNK88_RS07565 1479257..1479487 + 231 WP_001146444.1 putative cation transport regulator ChaB -
UMNK88_RS07570 1479645..1480340 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
UMNK88_RS07575 1480384..1480737 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3961.74 Da        Isoelectric Point: 9.1413

>T27440 WP_000170951.1 NC_017641:c1476412-1476305 [Escherichia coli UMNK88]
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T27440 NC_017641:c1476412-1476305 [Escherichia coli UMNK88]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGGACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT27440 NC_017641:1476460-1476526 [Escherichia coli UMNK88]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB E3PKK3

Antitoxin

Download structure file

References