Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 608818..609617 | Replicon | chromosome |
Accession | NZ_CP119746 | ||
Organism | Escherichia coli strain E15 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | F4VJD3 |
Locus tag | P1J19_RS02940 | Protein ID | WP_000347266.1 |
Coordinates | 608818..609282 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | P1J19_RS02945 | Protein ID | WP_001307405.1 |
Coordinates | 609282..609617 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1J19_RS02910 (603820) | 603820..604254 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
P1J19_RS02915 (604272) | 604272..605150 | - | 879 | WP_001315856.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
P1J19_RS02920 (605140) | 605140..605918 | - | 779 | Protein_571 | PTS N-acetylgalactosamine transporter subunit IIC | - |
P1J19_RS02925 (605929) | 605929..606402 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
P1J19_RS02930 (606425) | 606425..607705 | - | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
P1J19_RS02935 (607954) | 607954..608763 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
P1J19_RS02940 (608818) | 608818..609282 | - | 465 | WP_000347266.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
P1J19_RS02945 (609282) | 609282..609617 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
P1J19_RS02950 (609766) | 609766..611337 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
P1J19_RS02955 (611712) | 611712..613046 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
P1J19_RS02960 (613062) | 613062..613832 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17841.18 Da Isoelectric Point: 9.4947
>T274391 WP_000347266.1 NZ_CP119746:c609282-608818 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A836NGD2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |