Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 763610..764303 | Replicon | chromosome |
| Accession | NZ_CP119740 | ||
| Organism | Escherichia coli strain E94 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | P1J23_RS03770 | Protein ID | WP_000415584.1 |
| Coordinates | 763610..763906 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | P1J23_RS03775 | Protein ID | WP_000650107.1 |
| Coordinates | 763908..764303 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1J23_RS03740 (759285) | 759285..759599 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
| P1J23_RS03745 (759630) | 759630..760211 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| P1J23_RS03750 (760321) | 760321..761670 | - | 1350 | WP_000673406.1 | quorum sensing histidine kinase QseC | - |
| P1J23_RS03755 (761667) | 761667..762326 | - | 660 | WP_001221491.1 | quorum sensing response regulator transcription factor QseB | - |
| P1J23_RS03760 (762478) | 762478..762870 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| P1J23_RS03765 (762923) | 762923..763405 | + | 483 | WP_000183494.1 | GyrI-like domain-containing protein | - |
| P1J23_RS03770 (763610) | 763610..763906 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| P1J23_RS03775 (763908) | 763908..764303 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| P1J23_RS03780 (764436) | 764436..766043 | + | 1608 | WP_001324265.1 | ABC transporter substrate-binding protein | - |
| P1J23_RS03785 (766181) | 766181..768439 | + | 2259 | WP_001748758.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 751882..764303 | 12421 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T274364 WP_000415584.1 NZ_CP119740:763610-763906 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT274364 WP_000650107.1 NZ_CP119740:763908-764303 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|