Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 641653..642452 | Replicon | chromosome |
| Accession | NZ_CP119734 | ||
| Organism | Escherichia coli strain E92 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | S1NYM6 |
| Locus tag | P1J22_RS03185 | Protein ID | WP_000347251.1 |
| Coordinates | 641653..642117 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | P1J22_RS03190 | Protein ID | WP_001307405.1 |
| Coordinates | 642117..642452 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1J22_RS03155 (636654) | 636654..637088 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| P1J22_RS03160 (637106) | 637106..637984 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| P1J22_RS03165 (637974) | 637974..638753 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| P1J22_RS03170 (638764) | 638764..639237 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| P1J22_RS03175 (639260) | 639260..640540 | - | 1281 | WP_000681903.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| P1J22_RS03180 (640789) | 640789..641598 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| P1J22_RS03185 (641653) | 641653..642117 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| P1J22_RS03190 (642117) | 642117..642452 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| P1J22_RS03195 (642601) | 642601..644172 | - | 1572 | WP_001273761.1 | galactarate dehydratase | - |
| P1J22_RS03200 (644547) | 644547..645881 | + | 1335 | WP_000599652.1 | galactarate/glucarate/glycerate transporter GarP | - |
| P1J22_RS03205 (645897) | 645897..646667 | + | 771 | WP_001058214.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T274333 WP_000347251.1 NZ_CP119734:c642117-641653 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJ20 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |